(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE172

AE017197.PE172       Location/Qualifiers
FT   CDS_pept        227318..227791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0178"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03662"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XI0"
FT                   /protein_id="AAU03662.1"
FT                   /translation="MHFLFIIISFCLMSSCNLKSVYSEKYSRNNDLEAIKVEPIRTIEG
FT                   AEFYHHLTRILPQKAKAKYLLKAELSATTMPATIEKNSNILREDINQLVRYKLLDIESQ
FT                   NILIEETFCQNTSYNAIFTPYATNVERYGTGIDLAYQAAEEIRSRLILYFIRQ"
     atgcattttt tatttataat aatttcattc tgtctaatga gcagttgtaa tttaaaatca        60
     gtatatagtg aaaagtacag taggaataat gatttagaag ctattaaagt tgaaccgatt       120
     cgaacaatag aaggagctga attttatcat catttaactc gtattttacc tcagaaagca       180
     aaggcaaaat accttcttaa agccgagctt agtgcaacaa ctatgcctgc tactattgaa       240
     aaaaactcta atattttaag ggaggatatt aatcaattag ttagatataa attacttgat       300
     atagaaagcc aaaacatttt aattgaagag acgttttgcc aaaacacatc atataatgct       360
     atttttacac catatgcaac aaatgttgaa cgatatggaa caggaataga tttagcatac       420
     caagcagcag aagaaattcg tagtagatta attttatatt ttatacggca atag             474
//

If you have problems or comments...

PBIL Back to PBIL home page