(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE175

AE017197.PE175       Location/Qualifiers
FT   CDS_pept        230866..231252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0181"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03665"
FT                   /db_xref="GOA:Q68XH7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH7"
FT                   /protein_id="AAU03665.1"
FT                   /translation="MLIFLEVKYMNFHNRKLDEELIDYNISLRILFTILSVAIIMVAFD
FT                   SLATSVSDPVGDALCKLIKVFRGNTAKGIAVVGIIVLGIQTLRGKLQWEVALVVVTAII
FT                   ILFKAPDIVNMVSSDNNSSNCGVS"
     atgctaattt ttcttgaggt aaaatatatg aactttcata atcgtaaatt agacgaagaa        60
     ttaatcgatt ataatatatc attacgtata ttatttacta ttctaagcgt agctattatt       120
     atggtggctt ttgatagttt agccactagt gtgagcgatc ctgtaggtga tgcattatgt       180
     aagttaatta aagtatttag aggcaatact gcgaaaggta tagctgttgt aggtataatt       240
     gttttaggaa ttcaaacatt aagaggaaaa ttgcagtggg aagtagcttt agtagtagtt       300
     actgcaataa ttatattatt taaagcacca gatattgtga atatggtgtc aagtgataat       360
     aatagctcaa attgtggtgt ttcttaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page