(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE180

AE017197.PE180       Location/Qualifiers
FT   CDS_pept        complement(238564..239010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03670"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XH2"
FT                   /protein_id="AAU03670.1"
FT                   /translation="MTKNTIFKNILIPIDLNDKKSIKSIFSKALMLAINFQAKLHFMYV
FT                   MPEFGTKMFEDYLPKNWRTEKKEKYQTQIKDIIKQYIPDTIETDDYIGSGAVYDEIIKH
FT                   SNEIKADLIIISAVRLQLKDYMLGPNASKIVRHSDISVLVLRDE"
     atgactaaaa acacgatatt taaaaatata ttgataccta tagatttaaa tgataagaaa        60
     tctataaaaa gtattttttc taaggcttta atgcttgcaa taaattttca agcaaaatta       120
     cattttatgt atgtaatgcc tgaatttggt actaaaatgt ttgaagatta tttacctaaa       180
     aattggagaa cagaaaaaaa agaaaaatat caaactcaaa ttaaagacat tatcaaacaa       240
     tatattcctg atacaattga aacggatgat tatataggta gcggggcagt ttatgatgaa       300
     ataattaagc actctaatga aattaaagca gatttaataa taatctctgc agtcagacta       360
     caattaaaag attatatgct tggacctaat gcttctaaaa tcgtacgtca ttcagacata       420
     tcagttttag tactacgaga cgagtaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page