(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE197

AE017197.PE197       Location/Qualifiers
FT   CDS_pept        complement(262825..264594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0205"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03687"
FT                   /db_xref="GOA:Q68XF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XF5"
FT                   /protein_id="AAU03687.1"
FT                   /translation="MIKYHALSKSTFSLGIYFLKFDKIKITLLTVICILFGIIPAMDSI
FT                   LLQKIIDLIESFSDENAHNLLSSMIYWAIFYALWWESINIAYRAYDYLYLKTMPVIKGK
FT                   ILNELYNYTQYHSHKFFQENLAGHISNRITETARSFEMIISIFGEKLLRKLAIIVFALI
FT                   ALYLVHYAFATIFILWITVFIGLSILFSDKMNQYSLNYARSQSFVAGSIVDAISNINAV
FT                   RMFTAHKFERQHLETRVENAVADEQTMQFFMFKLRYSLGMSCSIMIFIMIYYLSRLRSE
FT                   LSISIGDCVLVLTLCINVADDIWDLTQEIGDMFEQIGAFNQGLSLMAPHIITDIENATP
FT                   LHIEAGIIEFRNVTFKYYNNNNLFYNKSVLIPSKQKVGLVGFSGSGKTTFISLLTRLHD
FT                   IEDGMILIDNQNIKNVTQDSLRKAISLIPQEPVLFHRTILDNIRYGKKDATLDEIIEAA
FT                   KAAHIHDVIDNLPDGYDTMCGERGNNLSGGQRQRIIIARAILKNAPILILDEATSSLDS
FT                   ETESMIQDSMDYLMKNKTVIVIAHRLSTLLNMDRILVFEAGSIIDDGSHTELLKNSKLY
FT                   KKLWNSQIKGLIV"
     gtgatcaaat accatgcttt atctaaatct acatttagct taggtattta ttttttaaaa        60
     tttgataaaa ttaaaattac gttattgact gtaatttgta ttttatttgg cattattcca       120
     gcaatggata gtatattact tcaaaaaatc attgatctaa ttgaatcttt tagtgatgaa       180
     aatgctcata acttattgtc ttcaatgatt tactgggcaa tattttatgc tctttggtgg       240
     gagagtatta atatagcata tcgtgcatat gattatttgt atctcaaaac tatgccagta       300
     ataaaaggga aaatactaaa tgaactttac aattatacac aatatcatag ccataaattc       360
     tttcaggaga atctagcagg acatattagc aatcgtatta ccgaaactgc aaggtcattt       420
     gagatgatta tttctatatt cggtgaaaaa cttctacgta aacttgctat tattgtgttt       480
     gcattaattg ctttatattt agtacattac gcttttgcta caatatttat tttatggatt       540
     acagttttta taggccttag tattcttttc tcagataaaa tgaatcaata ctcattaaac       600
     tatgctcgaa gccaatcctt tgttgccggc agtattgtag atgcaattag caatattaat       660
     gctgtaagga tgtttacagc acataaattt gaacgtcaac atttagaaac aagagtagaa       720
     aatgccgtag ccgatgaaca aactatgcaa ttctttatgt ttaaattacg ttactctctt       780
     ggcatgtcgt gttcaataat gatttttatc atgatttatt atttgtcacg acttcgtagt       840
     gaattatcta taagcatagg tgattgtgtg ttagtgctaa cattatgtat aaatgtagca       900
     gatgatattt gggatttaac tcaggaaatt ggtgatatgt tcgagcagat cggagcattt       960
     aatcagggtt tgtctttaat ggcaccacat attataacgg atattgaaaa cgctactccc      1020
     ttacatatcg aagcagggat tattgaattt agaaacgtca catttaagta ttacaataat      1080
     aataatctat tttataataa atcagtatta atacctagta aacaaaaagt cgggctagta      1140
     ggcttttcag gttcagggaa aactactttt attagtttac tcactagatt gcatgatata      1200
     gaagacggaa tgattttaat agataatcaa aatattaaaa acgtaactca agattcttta      1260
     agaaaagcaa ttagcctaat acctcaagaa ccagttcttt ttcatcgcac cattttagat      1320
     aacatcagat acggaaaaaa agacgctact cttgatgaaa ttatagaagc agctaaagca      1380
     gcacatatcc acgatgttat cgataatcta ccagatggtt acgatactat gtgtggagag      1440
     cgtggaaata atttatctgg cggtcagcgt caaagaatta tcatagcaag agccatctta      1500
     aaaaatgctc ctattttaat tcttgatgaa gcaacaagta gtttagatag tgagactgaa      1560
     agcatgattc aagattcaat ggattattta atgaaaaata aaactgtgat agtaattgca      1620
     catagattat ctactttact caatatggat agaattttag tttttgaagc aggcagcata      1680
     attgatgatg gtagccacac agaattatta aaaaatagta aactatataa aaagttatgg      1740
     aactctcaaa taaaaggatt gatagtgtaa                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page