(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE210

AE017197.PE210       Location/Qualifiers
FT   CDS_pept        280273..282033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0218"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03700"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XE2"
FT                   /protein_id="AAU03700.1"
FT                   /translation="MLNKLCEILFLINLLLVTGQGYASPPPLPQSLPIVAIDTPDKEDK
FT                   DVSTNFNISFFEKLKQFFSKQKKTNISSQQEKGQTKAIHKESQQIDPRELNENEQSEPF
FT                   IDVGSVILPSVANIHSKFEYENSTNLASNYNTQDMQVTQQELNSTEASESFIDIGNTKF
FT                   ISATNNEMYKEAVLPNDYKKTNLDFNIITLNVLKPVIPTSQDMMDVVPLQQPVQIYKPT
FT                   NLTSIPKLFNHDTNLNNVEKNLESTMSNMTTISPNMLSVPTTQDTIPTTLNITVPTTPT
FT                   TETHVNVPSSTMMHSNNHSTQPITTISINTPVDTSSTVVTATESSMAINNSQERFVSTS
FT                   EATKKQDWYTPIIPVLVVDPNKSRPNSLALEKKIDNDQIINNQAKSYPVSSSNVTLQKQ
FT                   NDKVNNETSELAKEFVKNETQMLFLPDDDIVLGKLTEHATLEQMDMYGYIKLFQKKEGW
FT                   IASMGKRKLVESFIKYDIDINKNKDIYSNLSYYSAVDNAFRAVARNNLFELRALLDVYP
FT                   ILQEKNSTGETLLTAAIYNDNYYLAKFLVIRGIKTSVLKKDECKYPLDIASSQGNTNIV
FT                   CMLMKAKGYN"
     atgttaaata aattatgtga gatattattt ttgatcaatc tattattggt gacagggcaa        60
     ggttatgctt cgcctccgcc attaccacaa tcattaccta ttgttgctat agatactcca       120
     gataaggaag ataaggatgt tagtactaat ttcaatattt ctttttttga gaaattgaag       180
     caatttttta gtaaacaaaa aaagacaaat atatcatctc aacaggaaaa gggacaaact       240
     aaagcaatac ataaagaatc acaacagatc gatcccagag agcttaatga aaatgaacaa       300
     tccgagccat ttatcgatgt tgggagtgta atattgccta gtgttgcaaa tattcatagt       360
     aagtttgagt atgaaaatag tacaaattta gcttcaaatt ataatacaca agatatgcaa       420
     gttacacaac aagagcttaa ttcaacagaa gcgtctgaat cttttataga tattggtaat       480
     acaaagttca ttagtgcaac aaataatgaa atgtataagg aagcagtttt acctaatgat       540
     tataaaaaga cgaatttaga ttttaatatt atcactctta acgtactgaa gcctgtcatc       600
     cctacatctc aagacatgat ggatgtagta cctttgcagc aaccagtgca aatatataaa       660
     cctactaatt tgacatctat tcctaagcta tttaatcacg atactaatct taataacgta       720
     gaaaaaaact tagaatcgac tatgtctaat atgactacta tttctccaaa tatgctaagt       780
     gttcctacaa cacaagatac tataccaact actctaaata taacagttcc tactactcct       840
     actacagaaa cgcatgttaa tgtaccatca tctacaatga tgcattcaaa taatcattct       900
     acacagccta taacgacgat tagcataaat acacctgttg atacttcgtc tacagtagtg       960
     accgcaacag agtcttctat ggcaataaat aactcgcaag aaagatttgt ttctacttca      1020
     gaggctacaa aaaaacaaga ttggtatact ccgattatac cagttcttgt agttgatccc      1080
     aataaatctc gacctaattc tttagcttta gagaaaaaaa ttgataatga tcaaattatc      1140
     aataatcaag cgaaatcgta tcctgtcagt tcttcaaatg ttacacttca aaaacaaaat      1200
     gataaggtaa acaatgagac ctcagaatta gcaaaagaat tcgtaaaaaa tgaaacgcaa      1260
     atgttatttt tacctgatga tgatatagtg ctgggtaaac taacagagca cgcgacttta      1320
     gagcagatgg atatgtatgg atatatcaag ttgtttcaaa aaaaagaagg gtggattgca      1380
     agtatgggaa aaagaaaact tgtagagagt tttattaaat atgatattga tatcaataaa      1440
     aataaagata tttattctaa tctatcttat tatagtgcag tagataatgc atttagagca      1500
     gttgcaagaa acaacctttt tgagttacgt gcattacttg atgtttatcc gatattgcaa      1560
     gagaaaaata gtaccggtga gacattactc actgctgcta tttataacga taattattat      1620
     ttagctaaat ttttggttat acgaggtatt aaaacttctg ttctaaaaaa ggatgagtgt      1680
     aaatatccat tagatattgc atcctctcaa ggaaatacta acatagtttg catgttaatg      1740
     aaagctaagg ggtataatta a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page