(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE215

AE017197.PE215       Location/Qualifiers
FT   CDS_pept        288306..288968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0223"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03705"
FT                   /db_xref="GOA:Q68XD7"
FT                   /db_xref="InterPro:IPR022588"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD7"
FT                   /protein_id="AAU03705.1"
FT                   /translation="MTDILDEVLSDQNEEKRLIFFKKLVLIIIIISIVAITIMVIINNN
FT                   KDNRIKNNKKNGDILVKTIGLDTTKANNELAFNTLENLVTSSNTKIKEIAALEQVALKI
FT                   SEKKYLEAKELLNKIIENKEYSEISTSYARISWCCIVLDDQNLDIQDKEKLQKYLDYFD
FT                   DEKKPFWATATIIKSILDIKHNMKTQAEKNLKNLLASNNVSDLLKDQAKALLVNLSK"
     atgacagata ttttagatga agtactgagt gatcaaaatg aagaaaaaag gttaattttt        60
     ttcaaaaagc ttgtactgat tataataatc atttctatag tagctattac tataatggtt       120
     attattaata ataataaaga taacagaatt aaaaataata aaaaaaatgg cgatatcctt       180
     gttaagacta ttggtttgga cacaacaaaa gctaataacg aattagcttt taatacttta       240
     gagaatttag ttactagtag taatactaaa ataaaagaaa tagctgcatt agaacaagta       300
     gcgctaaaga tatcagaaaa aaaatattta gaagcaaaag agcttcttaa taaaattatt       360
     gaaaataaag aatattccga aatttctact tcttatgcac gaatttcatg gtgctgtatt       420
     gttcttgatg atcaaaatct tgatattcaa gataaggaaa aattgcaaaa atatttagac       480
     tattttgatg atgagaaaaa accgttttgg gctacagcaa ctattataaa atctattttg       540
     gatattaagc ataatatgaa aacgcaagca gagaaaaatc taaaaaattt attagcttcg       600
     aataatgtat cggatttgtt aaaagatcaa gctaaagcat tgcttgtaaa tttaagtaaa       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page