(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE220

AE017197.PE220       Location/Qualifiers
FT   CDS_pept        complement(293404..294756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0229"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03710"
FT                   /db_xref="GOA:Q68XD2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XD2"
FT                   /protein_id="AAU03710.1"
FT                   /translation="MTTILVVDDIETNIKLLTAKLLKEYYTVLTANSGKEALSILKKEK
FT                   IDTILLDVMMPEMDGFEVCKIIKTDPGTTHIPVVMITALSDIDDRVKGLEAGADEFLIK
FT                   PINDTALFVRLKSLSRMKSLIDELKLRNSTNALLGVTNIEIHDNLTDKKILLINDDVVQ
FT                   AKNIKQILVKLTKYVKVISNSDELDIINEYTPDLVIISSTLENEDPLRISVILRGKAEI
FT                   SGVVIILQIDEDGMPLVVKGIELGINDYFIYPIEENELLARIRTQLRRKQYQDNLRNDL
FT                   EQSVNLAAKDGLTGLFNRRYFDIHLKQMIEKANKENIKLYLLMCDIDNFKHVNDTYGHQ
FT                   AGDKVLTIVSRILKNTLRVTDLIARFGGEEFTILLTDIDISKAIETAERIRVKIEYMDF
FT                   YIEGQIEPLKKTISIGVTEYKKEESIESIIKRADKAMYKAKTTGKNKVVQL"
     atgaccacaa tattagtagt agacgatata gaaaccaaca ttaagttact aacagcaaaa        60
     cttttaaaag agtactatac agttcttact gcaaatagcg gaaaagaagc attatcaatt       120
     cttaaaaagg agaaaatcga tactatactc cttgatgtta tgatgccgga aatggatgga       180
     tttgaggtat gtaaaataat caaaacagat ccaggcacta ctcatatacc tgttgtaatg       240
     atcactgcac tttctgatat tgatgatcga gtaaaaggtc ttgaagcagg agctgatgaa       300
     tttttaataa agcctattaa tgatactgct ttatttgtaa gactgaaatc actatctaga       360
     atgaaaagct taattgatga gttaaaactt cgtaatagta ctaatgcatt attaggcgta       420
     acaaatatcg aaattcatga caatttgaca gataaaaaaa tattactcat taatgatgat       480
     gtagtacaag ctaaaaatat aaaacaaatt ctagttaaac ttaccaagta cgtaaaggta       540
     ataagtaatt cagatgaatt agatattata aatgaatata caccagattt agtcattatc       600
     agcagtacac ttgaaaatga agatccttta agaatcagtg ttattttaag aggtaaagca       660
     gaaataagtg gcgtggtaat aattttacaa attgatgaag atggaatgcc tttagttgta       720
     aaaggtattg aactcggcat taatgattat ttcatttatc ctatagaaga aaatgaatta       780
     ctggctagga ttagaacaca attaaggcgt aaacaatatc aagataattt acgtaatgat       840
     cttgaacaaa gtgttaattt agcagctaaa gatggtctaa caggtttatt taatcgtcgt       900
     tattttgata tacatctcaa acaaatgatt gagaaagcta ataaagaaaa tattaaatta       960
     tatttactga tgtgtgatat agacaatttt aaacatgtaa acgatactta cggtcatcaa      1020
     gcaggagata aggttttaac aattgtatca cgtattttga aaaatactct cagagtaaca      1080
     gacttaatag caaggttcgg tggtgaagaa tttactatac ttttaacaga tatagatatt      1140
     tctaaagcaa ttgaaactgc ggaaagaatt agagtaaaaa tagaatatat ggatttttat      1200
     attgaaggtc aaattgaacc gttaaaaaaa actatttcaa taggagtaac ggaatataaa      1260
     aaagaagaat cgatagaatc gatcattaaa cgtgctgaca aagcaatgta taaagctaaa      1320
     acaactggaa aaaataaagt agtacaatta taa                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page