(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE223

AE017197.PE223       Location/Qualifiers
FT   CDS_pept        296355..296678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0232"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03713"
FT                   /db_xref="InterPro:IPR021277"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XC9"
FT                   /protein_id="AAU03713.1"
FT                   /translation="MASYKEFEFDCDFGGQRAKFKFYIGTPQEGHHPLQFQAKWLSDER
FT                   GGTIPDEVMKAISQLNDLAKKNSVPLPDLCVYALGSAQEAKASTHEEDADDLENQDDNA
FT                   EPV"
     atggcatctt ataaagagtt tgaatttgat tgcgattttg gtggacaaag agcaaaattt        60
     aagttttata taggcacacc acaagaaggg catcatccgc tgcaatttca agcaaaatgg       120
     ttatctgatg aaagaggcgg tactattcct gatgaagtga tgaaagcaat atcgcagcta       180
     aatgatcttg caaaaaagaa ctctgtccca ctgccagatt tatgcgtgta tgctcttggt       240
     tctgctcaag aagcaaaagc tagcactcac gaagaggatg cagacgatct tgagaaccaa       300
     gatgataatg cagagccggt atag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page