(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE238

AE017197.PE238       Location/Qualifiers
FT   CDS_pept        complement(310675..311820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0247"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03728"
FT                   /db_xref="GOA:Q68XB4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XB4"
FT                   /protein_id="AAU03728.1"
FT                   /translation="MTLKNDYKTIFFSLFGIFIFSCINAINFYNFKIFLLIKNLGGEQI
FT                   NNINQTKFIGSIIAGFSLTQLINKLSNKIIILISLSLLIICTINLIILNNYTLIKINFI
FT                   LINFGIFSYFTSITLDIIEISKDKKYLFLACIILLWACGNLMIDLLNPFIKLTNNTMVI
FT                   CALLYCINILTEFRHDNHTSNKLHLNFKFSSLIKNIELQLLTGFIVSYITLNILWYYEA
FT                   FALKKQLALINLKLILKYIFLAICFSIIPICYILNKINKYFANLALNTILLICFILLPI
FT                   HGTNKNLNILYIILIGNCLGAIFICNILILIAKFRDYELRTALLSYFSMCSIGIYAGAL
FT                   SSHIPYGTINGSDVLFSVFSIIGSFVTYHFWYFIKYKLYRF"
     atgactttaa aaaacgatta taaaactatt tttttttcac tttttggaat atttattttt        60
     tcctgtatca atgctataaa tttttataat tttaaaattt ttttactgat taaaaattta       120
     ggtggagaac aaataaataa tataaatcaa actaaattta taggttcaat aatagcaggc       180
     ttttccttaa cgcagttaat taataaatta agtaataaga taattatttt aattagctta       240
     tctttattaa ttatatgtac aataaacctc attatattaa ataattatac tttaattaaa       300
     attaatttta ttttaattaa ttttggaatc ttttcatatt tcacttctat aacattagac       360
     attatcgaga ttagcaaaga caaaaaatat ctttttctag cttgtataat attgttatgg       420
     gcgtgtggaa acttaatgat agatttatta aatccattta taaaactcac aaataatact       480
     atggtaattt gtgcattatt atactgtatc aatatactaa ccgaatttcg gcatgataat       540
     cacacatcta ataaattaca tttaaatttt aaattttcat ctttaataaa aaatattgaa       600
     ttacaattat taacaggctt tatagtttct tatatcacct taaatatatt atggtattat       660
     gaagcttttg cattaaaaaa acaattagca ttaattaatt taaaactcat actaaaatat       720
     atttttttag caatatgttt ttctataatt cctatatgtt acatattaaa caaaataaat       780
     aaatattttg ctaatttagc actaaatacc attttactta tctgctttat tttactacca       840
     attcatggga ctaataaaaa ccttaatata ttatatataa tactaattgg taattgttta       900
     ggagccattt ttatttgtaa tattttaata ctaattgcta aattccgaga ttacgaactc       960
     aggacagctt tattgtcata tttttcaatg tgcagcatcg gcatatatgc tggagcttta      1020
     tcatcacata taccttacgg cactattaat ggaagtgatg ttttattctc agttttttct      1080
     ataattggta gttttgtaac ttatcatttt tggtatttta ttaagtataa attatatagg      1140
     ttctaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page