(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE251

AE017197.PE251       Location/Qualifiers
FT   CDS_pept        328758..329216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0260"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03741"
FT                   /db_xref="GOA:Q68XA1"
FT                   /db_xref="InterPro:IPR022714"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XA1"
FT                   /protein_id="AAU03741.1"
FT                   /translation="MWRALRRLIAANPMGFFLWSIITKWYLIIAVASLITLYYTVLGLK
FT                   KIGFIDYFGRETEDILSQSKAVAQNCIPKLKLVNGKLPLREFWNCLSDPGEYQHEEVTG
FT                   AKVLEDEINKFMQKQADSISDTVPPIINPYEKLENQNNLNNALNDNNR"
     atgtggcgtg ctttacgaag gttgattgca gcaaatccta tggggttctt tttgtggtct        60
     attatcacta aatggtattt aattatagcg gttgcgtcat taattacttt atattataca       120
     gtattaggct taaaaaaaat cggatttata gattattttg gtcgtgaaac ggaggatata       180
     ttatcacaaa gtaaagcagt tgctcaaaat tgtattccta aactgaaact tgtgaatggt       240
     aaattaccac tgcgtgaatt ttggaattgc ttaagtgatc ctggagaata tcagcatgaa       300
     gaagtcacag gtgcaaaagt gttagaagat gaaataaata agttcatgca aaaacaagca       360
     gatagtattt cagatactgt gcctcctata attaatcctt atgaaaaact agaaaatcaa       420
     aataatctta ataatgcact aaacgataat aatcgctaa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page