(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE270

AE017197.PE270       Location/Qualifiers
FT   CDS_pept        353669..354400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0280"
FT                   /product="VirB8-like protein of the Type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03760"
FT                   /db_xref="GOA:Q68X82"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR026264"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X82"
FT                   /protein_id="AAU03760.1"
FT                   /translation="MNNIFGFFKSSNNTQSGSGGKQNHESIKSTNPLKISQNWYEERSD
FT                   KLIVQRNLLIILIILLTIFMVISTLVIAFVVKSKQFDPFVIQLNSNTGRAAVVEPISSS
FT                   TLTVDESLTRYFIKKYITARETYNPVDFATIARTTVRLFSTSAVYYNYLGYIRNKDFDP
FT                   TLKYKADNTTFLVIKSWSKIAEDKYIVRFSVNETSGSQLVYNKIAVVSYDYVPMQLTDS
FT                   ELDINPVGFQVNGYRVDDDNS"
     atgaataata tatttggctt ctttaaatca agtaataaca cgcaaagtgg ttcaggaggt        60
     aaacaaaatc atgaaagtat taaatcaact aatcctttaa aaattagtca gaattggtat       120
     gaagagcgat ctgataaatt aattgttcag agaaatttgc tgatcatatt aataatacta       180
     ctaaccattt ttatggttat atcaactttg gtcatagcat ttgtagtaaa gtctaaacag       240
     tttgatcctt ttgtgatcca gcttaatagt aatactggac gtgctgcggt tgtagaacct       300
     atttcatcat cgacgttaac tgtagatgag tctcttacaa gatattttat aaagaaatat       360
     ataacagcac gtgaaacata taatccagtt gattttgcaa cgatagctcg tacgacagtc       420
     agattatttt caacaagtgc tgtttattat aattatcttg gctatataag aaataaagat       480
     tttgatccta ctttaaaata taaagcagat aatactacat ttttagtaat aaagtcatgg       540
     tctaaaatcg cagaagataa atacatagtt agattttctg taaatgaaac atcaggaagc       600
     caattagttt ataataaaat cgcggtagta agttatgatt atgtgcctat gcaattaaca       660
     gattcagaac ttgacataaa tcccgtaggg tttcaagtta acggatatag ggtagacgat       720
     gacaatagtt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page