(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE276

AE017197.PE276       Location/Qualifiers
FT   CDS_pept        362555..363442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0286"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03766"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X76"
FT                   /protein_id="AAU03766.1"
FT                   /translation="MFRKFLFIPLLIVTSLVKAEIIEVDSLSKITQDFKVNYNKNYLPQ
FT                   DLLVVTVLDKFLFKPFGIPIGEYIDQRRYLELAPLFSQINKNSKIIYIAQLILTNDSYK
FT                   KELQESDFPSFVNEISNSQIPIIAVNNGFTGNFNNIPKFEIWFADYLKKNFYIDFSKSF
FT                   PNNNYIIFNNLDSFANTYPVFYKGILTSNNISVAQVILNFLIQINFIPKCFILISSNRE
FT                   LIRSMEFQLNNHSSNILFIGYHYNNKTISAHKDIVYYTKMINDLIPQINKLKRNNPPLK
FT                   NNNAKSKNSYETHK"
     atgtttagaa aatttttatt tattccacta ttaattgtta cttctttagt gaaagcagaa        60
     attatagaag tggatagttt aagtaaaata acacaagatt tcaaagtaaa ttataataaa       120
     aattatctac cgcaggattt attagtagta acggttctag ataagttttt atttaagcct       180
     tttggtatac ctattggtga atatattgat cagcgtaggt atcttgagct agctcctctt       240
     ttcagtcaaa ttaataaaaa ttctaaaatt atttatatag cacaattgat tttaactaat       300
     gatagttata aaaaagaatt acaagaatct gattttccaa gttttgtaaa tgaaattagt       360
     aatagtcaaa tcccaataat agcagtaaat aatgggttta ctggtaattt taataatatt       420
     cctaaatttg aaatatggtt tgctgattat ttaaaaaaaa atttttatat tgatttttca       480
     aagagttttc caaacaataa ttatattatt tttaataatt tagatagttt tgctaatact       540
     tatccagtat tttataaggg tatattgact agtaataata tatcagtcgc acaagtgata       600
     ctcaattttc ttattcaaat taattttata ccaaaatgct ttatactgat tagtagtaat       660
     agagagttga tacgttctat ggaatttcag cttaataatc atagttctaa tatattattt       720
     attggttacc attataataa taaaactatt tcagcgcata aagatattgt atattatact       780
     aaaatgatta atgatttaat acctcaaata aataagctca aaagaaataa tccaccttta       840
     aagaataata atgcgaaaag taaaaattct tatgaaacgc ataaataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page