(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE277

AE017197.PE277       Location/Qualifiers
FT   CDS_pept        363426..364250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0287"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03767"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X75"
FT                   /protein_id="AAU03767.1"
FT                   /translation="MKRINKVLLSLLCLVIAYAGYSQIIPTYSVDSVTIQNLLPQVDAD
FT                   TLVLINIDNTIITPKSKLFRYQDNAYINFTKYLYSLAAHNASVNKTIAKLIVQRQMMLV
FT                   ESQWVDLINKMKNQGATVLGLQEITAPCNLIENYEGWLYTILYGLNINFTRKVNDKEVF
FT                   RFNPSDAEAPIFYLGIIFTGNLNKVNTLIEFLNIIPIPPKKIVIFANNKKDLENIDSYL
FT                   SMVDIGYYGIEYFGWQMLPGSPDNQIAEFQQSTFLNTGQWLEDDTAAKMLNK"
     atgaaacgca taaataaagt tttattgagt ttactttgct tagttattgc atatgcaggt        60
     tatagtcaaa ttattcctac ttattctgta gactcggtaa caatacaaaa tttattacca       120
     caggtagatg cagatacatt ggtattgata aatatagata atactatcat cacacctaaa       180
     tctaaattat ttcgatatca agataatgct tatattaatt tcacgaaata tttatatagt       240
     cttgcagcgc ataacgcatc agttaataaa actattgcaa aattgatagt gcagcgtcaa       300
     atgatgcttg ttgaatctca atgggtagat ttaattaata agatgaaaaa tcaaggtgca       360
     acagtattag gtcttcaaga aataacagct ccatgtaatt taattgagaa ttatgaagga       420
     tggttatata ccatacttta tggactcaat attaatttta ctcgtaaagt taatgataaa       480
     gaggtattta gatttaatcc aagtgatgct gaagctccta ttttttattt aggtataata       540
     tttaccggta atttaaataa agttaacact cttatagagt tcttaaacat tataccaata       600
     ccacctaaaa aaatagtaat ttttgcaaat aataaaaaag atttagaaaa tatagactct       660
     tatttaagta tggttgatat aggatattat ggaattgaat attttggatg gcaaatgttg       720
     cctggatcac ctgataatca aattgctgag tttcagcaat ctacgttttt aaatactggt       780
     cagtggttag aagatgatac ggctgcaaag atgttaaata aataa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page