(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE29

AE017197.PE29        Location/Qualifiers
FT   CDS_pept        complement(39009..41033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0031"
FT                   /product="VirB6-like protein of the type IV secretion
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:RT0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03519"
FT                   /db_xref="GOA:Q68XX3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XX3"
FT                   /protein_id="AAU03519.1"
FT                   /translation="MKTLKALKIFIIVYISSVSLESFAGFGESCSNLPITSDGYLETYT
FT                   AYGYIIRSIDMKDPRGNCNPYTSSITFCFKNVEGSTSPCTIYTLNEGDARKISDLSTDN
FT                   NPNLGANTVLKNIVLTVKKFGNDLCLAMPTSRGPMPVACKSLNATPAPTNPKYENCNIG
FT                   KSCYTGANYSQSLINFSGLAVQCLSETLNKIFFTGNSCSSQDQNSRITHLAAFSTFQGY
FT                   LKRIIGAALILYTMFFAFNMALNKEYATTEKITLFIIKFLFVVYFSIGLEPLNFSGGQT
FT                   VKENGMLKYGLPLLTGAAPDFAEMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRI
FT                   GYYLGLDLLYNIDKNGILGHSVGNGPGGNNKPIPNFDPDSKKDRPHDLSKAGALRFFTV
FT                   MFGFLMSGHIIILVAGIAFSVIFLSILLYFITHYLVCMITIYVMTYISPIFIPMVLFTR
FT                   TKAYFDGWVKVCISCALQPAVVAGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFE
FT                   LRLPSIDADKCQESFGYKMLKYYAGEGWEEHLLILFPIKSIVRDVVSILAELLCVLVFS
FT                   VIFYYFSKSIGRFAADLTNGPNMDAVTASPTKIVDLVKKGAAFLQDASSVHAQGKSPVE
FT                   DKPDIGSKRKDGVQQGEDSENSSGGELADLASGSGGGKL"
     atgaaaactc ttaaagcttt aaagatattt attatagttt atatatcgtc tgtaagctta        60
     gaaagctttg ctggatttgg agaatcatgc tctaatttac cgattacttc agatgggtat       120
     ttagaaacat acacggcata tgggtatata attcgtagta ttgatatgaa agatccgaga       180
     ggtaattgta acccatatac gtctagtata acgttttgtt ttaaaaatgt agaaggtagc       240
     actagtcctt gtaccatata tactttaaat gaaggtgatg ctaggaagat tagtgattta       300
     agtactgata ataatcctaa tcttggtgca aatactgtat taaagaatat cgttttaaca       360
     gttaaaaaat ttggtaatga tctatgttta gctatgccta catcaagggg acctatgcca       420
     gtagcatgta aatctttgaa tgctactcct gctcccacta atcctaagta tgagaattgt       480
     aatataggca aaagctgtta tacaggagca aattatagtc aatcattaat taatttttct       540
     ggtcttgcag ttcagtgttt aagtgaaacc cttaataaaa tattttttac aggaaatagt       600
     tgtagttctc aagatcaaaa ttctagaata actcatcttg ccgctttttc tacatttcaa       660
     ggttatttaa agagaattat aggtgcggca ttaattcttt atactatgtt ttttgccttt       720
     aatatggctc ttaataagga atatgcaact actgaaaaaa taactctttt tataataaaa       780
     ttcttatttg ttgtatattt ttcgatcggt cttgaacctt taaattttag tggtggtcag       840
     acagtaaaag aaaacggtat gttaaaatat ggactgcctc ttttgactgg ggcagcacct       900
     gattttgcag aaatgatctt taatgcggca ggttctagag ggttatgtca gtttgataat       960
     tcaaagtata aggacggtta taaattttat ggtttatggg atgcgattga ttgccgtata      1020
     ggttattatc ttggtttgga tttactttat aatattgata aaaatggaat tttagggcat      1080
     tcagtcggta atggtcctgg cggtaataat aaacctatac ctaattttga tcctgatagc      1140
     aaaaaagata gaccacacga tttaagtaaa gcaggagcac tgagattttt tactgttatg      1200
     tttggatttt tgatgtctgg acacattatt atacttgtgg caggtatagc attttctgta      1260
     atatttttat ctatactttt gtattttatt acacattatt tagtttgtat gattaccatt      1320
     tacgttatga catatatttc gcctatattc attcctatgg ttttatttac tcgtacaaaa      1380
     gcttattttg acgggtgggt aaaagtatgt atttcatgtg cattacaacc tgcagtagta      1440
     gcaggtttta tagctctatt aataactatg tatgattctg caatatttaa aaattgtgaa      1500
     ttcttaagat atgattatga aaaaggtgat attagattta gtacttttga gttaaggctc      1560
     cctagcattg atgcagataa atgtcaagaa agctttgggt ataaaatgtt aaaatattat      1620
     gcaggtgaag gttgggaaga acatttattg atactctttc caataaaatc aattgttcga      1680
     gatgttgtat ctattttagc agaacttttg tgtgtattag tattttcggt tattttttat      1740
     tacttctcta aatctatagg acgctttgct gctgatttaa ctaatggtcc taatatggat      1800
     gcagtaacgg cgagtccaac taaaattgtt gatttagtaa aaaaaggagc agcattcctg      1860
     caggatgctt cttcagtaca tgcacaaggt aagtcacctg tggaagataa gccagatatt      1920
     ggtagtaagc gtaaagatgg agtgcaacaa ggtgaagatt ctgaaaacag ttctggagga      1980
     gagttagctg atttagcaag cggttctggt ggaggcaaat tatag                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page