(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE291

AE017197.PE291       Location/Qualifiers
FT   CDS_pept        382095..383057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0301"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03781"
FT                   /db_xref="GOA:Q68X61"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X61"
FT                   /protein_id="AAU03781.1"
FT                   /translation="MKNNQIKDHFTFFLSCSIILHLMLFYCVLFCMPSLLNKKFPEEQI
FT                   ISFEIFPLSDRSNIITQTKQKEDPIEHEDAKKSEQSKLTTEAPQVISQEKNAKERETET
FT                   IEEKSPIKESNTKEVKGTLLEQKGEVTQAKLNKEEGKTQGQKVRRPEVNKDNKKLLEIR
FT                   KEVKQKKHKTDELDSLLKNLEQSSEGDNVKSNKYQRLKKVDNPKEAKGVYTDMLPLSNS
FT                   ETSLIKRQIERHWINVPAGVRGNNKVKIIISITLDKAGNVEQVRVIAKICPNIQSSICE
FT                   ALVDNAIRAVWQASPIENLDPARFNHWKEMNFIFDPSKL"
     atgaaaaata atcaaattaa ggatcatttt acgtttttcc ttagttgttc tattattctg        60
     cacttaatgt tgttttattg tgttctgttt tgtatgccgt cacttttgaa taaaaaattt       120
     ccagaggagc aaattatctc ttttgagata tttcctctga gtgatcgatc aaatatcata       180
     acccaaacaa agcaaaaaga agatccgata gaacatgaag acgctaaaaa atctgagcag       240
     agtaagttaa caacagaagc accacaagta atatctcaag aaaaaaatgc taaagagcgt       300
     gagactgaaa caatagaaga aaaatcacct ataaaagaat caaatactaa agaagtaaaa       360
     ggaacattac ttgagcaaaa aggagaagta acgcaagcaa agcttaataa agaagagggg       420
     aaaactcagg gacagaaagt aagaaggcct gaagtaaata aagacaacaa aaaattgtta       480
     gagatacgta aagaggtaaa gcaaaaaaaa cataaaaccg atgagcttga ctctttactt       540
     aagaatttag agcaatcttc ggaaggagat aatgtaaaat ccaataagta tcaaagatta       600
     aaaaaagttg ataatccaaa agaagctaaa ggagtgtata ctgatatgtt acctctttca       660
     aatagtgaaa catctttaat caaaagacag attgaaagac attggattaa tgtaccagca       720
     ggagttagag gtaataataa ggtaaaaatc attattagta ttactctaga taaagcaggt       780
     aacgttgagc aagtaagggt tatagcaaaa atttgtccta atattcagtc tagtatttgt       840
     gaagctttgg tagataatgc aattagagca gtatggcaag caagtcctat agaaaatctt       900
     gacccagcac gttttaatca ttggaaagaa atgaatttta tttttgatcc aagtaaattg       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page