(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE298

AE017197.PE298       Location/Qualifiers
FT   CDS_pept        complement(390727..391110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03788"
FT                   /db_xref="GOA:Q68X54"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X54"
FT                   /protein_id="AAU03788.1"
FT                   /translation="MNIYVIYINSTQKNNNFIILEEGFSWIAALFSIFWALYHKMWVVV
FT                   TITVIANIIITTINIVDLKFIFQIFLILSFGFFASDIRENYLNRNNYQLEDIIIANSRI
FT                   EAELKFLERSILNLTKNGYANIK"
     atgaatatat acgtaatata cattaactca acacaaaaaa ataataattt tattattctt        60
     gaagaaggct tttcatggat agctgctctt tttagtatat tttgggcatt ataccataaa       120
     atgtgggtag ttgttactat tactgtaata gcgaatataa tcattacgac aattaatata       180
     gtagatttaa agtttatatt tcagatattc ttaatattaa gttttggctt ttttgcttca       240
     gatattagag aaaattattt aaatagaaat aattaccaac tagaagatat aataattgct       300
     aactctagaa ttgaagctga attaaaattt ttagaacgta gcatacttaa tttgacaaaa       360
     aacggatatg ccaatataaa ataa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page