(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE305

AE017197.PE305       Location/Qualifiers
FT   CDS_pept        397709..398281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0315"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03795"
FT                   /db_xref="GOA:Q68X47"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X47"
FT                   /protein_id="AAU03795.1"
FT                   /translation="MNSLFKILYLNRFVAHLNTNTYILDIVKIVIGVVAIFASAQITIP
FT                   IKPVAITMHSVILCIIAFTYSPRLSFLTILTFIFIGIMGLPVFCQFSSGINYFLGAAGG
FT                   YYLGFLIGIPVMSVLKGKLAENWVNVTIICIIGHIIFYLCGVIWLASIIGLKQAIYSGF
FT                   VIFIPSGLAKLLIFSCLFSYIKNIKSK"
     atgaattctc tatttaaaat attgtatctg aatagatttg tcgcacattt aaatacaaat        60
     acttatattc tagatattgt gaaaatagtt attggagtag ttgcaatttt tgcttcagca       120
     caaatcacta ttcctataaa acctgtagca attacaatgc atagcgtaat actttgtatt       180
     atcgctttta catatagtcc acgtcttagt tttctcacta ttttgacttt tatttttata       240
     ggtataatgg gtttgccggt attctgtcaa ttttctagcg gaataaatta ctttttagga       300
     gcagcaggtg gttattacct cggattttta atcggaattc ctgttatgag tgttttaaag       360
     ggtaagttgg ctgagaattg ggtaaacgtt actataattt gtattatcgg tcatattata       420
     ttttatctat gcggtgttat ctggcttgcc agtattatag gtttaaagca ggcaatttat       480
     agtggttttg taatttttat tccaagcggt cttgctaaac ttcttatctt ctcttgctta       540
     ttttcttata ttaagaacat aaaaagcaaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page