(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE310

AE017197.PE310       Location/Qualifiers
FT   CDS_pept        complement(406502..408064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03800"
FT                   /db_xref="GOA:Q68X42"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X42"
FT                   /protein_id="AAU03800.1"
FT                   /translation="MLKNILKHFDTKLIKLSSILAFLYCLLFNTAILIYKFDYYKATIF
FT                   KGILELSKDFCYIYIFAFIAFFGLNVHRFVLKFGAGFLFITSAIASYYIYFFKINPTKQ
FT                   VIGSFFSTDLNEVYELISIKLIIWIIFCLFTCFYTLRSFIAKNSKSFFTTLLSAACLLI
FT                   FIYNIITPSFKILKNYFPIQYLHNSYLNFATIFGDINYADISKQYHFIDNSDPDIIGVL
FT                   VIGESARFDHFGINGYKRDTTPYLNTTKNIISFKAESSYNLTYLSVPSLLSRYPANQIE
FT                   NSRLENTFLSILTRLGFNTTWIGTQTLMRNFANFDLSNIYNDVNFTIVPGGSALFSLND
FT                   HDEKILPFTKEIITKSGKQFLVLHTSGSHWNYNARYPKKFEHFTPICHIKVKGDASDCD
FT                   QLALMNSYDNSILYTDFLLSNIIGLLKDKNAFLLYVSDHGESLGENGYYGHGGPLLSEQ
FT                   ITVPFIVWVSDTFKTKYPESVDAIKSYSSTEISHDYVFHSILDCLNINSDIINKSLSLC
FT                   KSS"
     atgctaaaaa atattttaaa acatttcgat acaaaattaa ttaaattatc ttcgattcta        60
     gcctttcttt attgcttgtt atttaatacc gcaatattga tttataaatt tgattactat       120
     aaagcaacaa tttttaaagg aatattagag ttatcaaaag atttttgtta tatttatata       180
     tttgctttta tagcattttt cggtcttaac gtacatagat tcgtcttaaa atttggcgca       240
     gggtttttat ttataacatc tgctattgct agttattata tttatttctt caaaatcaat       300
     cctactaaac aagtaatagg gagttttttt tcaacggatt taaacgaagt gtatgaatta       360
     ataagcatta aattaataat atggataatt ttttgccttt ttacttgttt ttatacactg       420
     agatcgttta tcgcaaaaaa ttccaaatca tttttcacaa cactattatc ggctgcatgt       480
     ttacttattt ttatatataa cattattact ccttcattta aaatactaaa aaattatttc       540
     ccaattcagt atttacataa tagctacctt aattttgcta caatttttgg tgatataaat       600
     tatgcagata ttagcaaaca atatcacttt atagataact ctgaccctga tattatagga       660
     gttttagtta taggagaatc agcaagattt gaccattttg gtattaacgg ttataaaaga       720
     gatacaactc catacttaaa tactactaaa aacataattt ctttcaaagc ggaatcttct       780
     tataacctta catatctttc tgtaccgtca ttactttcac gttatcctgc aaatcaaatt       840
     gaaaatagta ggctagagaa cactttttta tcaattttaa caagacttgg ctttaatact       900
     acttggattg gtactcaaac tttaatgaga aattttgcaa attttgacct tagtaatatc       960
     tataatgatg ttaattttac tatagtgcca ggcggatctg ccttattttc tttaaatgat      1020
     catgatgaaa aaatattgcc atttacaaaa gaaattatta caaaatcagg aaaacaattt      1080
     ttagtattgc atacgtcagg aagccattgg aattataacg caagatatcc aaaaaaattt      1140
     gaacatttta ccccgatctg ccatattaaa gtgaaaggtg atgcaagcga ttgtgatcag      1200
     ctggctttaa tgaacagtta tgataactca attttataca ctgatttttt gttatctaat      1260
     ataattggat tactaaaaga taaaaatgca tttttattat atgtgtcaga tcacggcgaa      1320
     tctcttggag aaaatggcta ttatggtcat ggcggtccac tactttcaga acaaataaca      1380
     gtcccattta tagtttgggt atcagatact tttaaaacaa aataccctga atcggtagat      1440
     gcaattaaaa gttattctag taccgagatt agtcatgatt atgtatttca ttcaatcctt      1500
     gactgtttaa atataaattc ggatatcata aataaaagct taagtctatg taaatctagt      1560
     taa                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page