(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE328

AE017197.PE328       Location/Qualifiers
FT   CDS_pept        430167..432794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0338"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03818"
FT                   /db_xref="GOA:Q68X24"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X24"
FT                   /protein_id="AAU03818.1"
FT                   /translation="MIKKIVVGIIICFALLFIIFSVLSFMNYNLVTNNFINHFGIARED
FT                   IRKIKIHKFPLPYLCIDTIKEDGKLDLEQIKIHFSLWSLIKFNPKINKIDILDAKFYAN
FT                   ANVFNIYNHEELIKNFFKYKLQNINLHITNLSIFNKQDYSILNFNNCVLKKANALSSHY
FT                   IFNTTSNNIGRISGSINKRDDIVDFRLNVDNNDYGSKLSQLYKDFKFTRGTGEYQIKNL
FT                   ASVMYNILPDLKHLLNKFNQTEPVNIKFNIANNEDEIELKDIVIESSLIIGNGFVNIAK
FT                   NTNITTNVQLNFPKIDLRSLILPNAVVKFNTFGSNIRFIFADKLLKANVAINEIILSNN
FT                   EALEKIVFAANLSNGTLNINELSGNIKSGGEFRLTGNVTQNAVRSMFDGKLYLKHNDMN
FT                   SLLNILGFNNLTIQESVPFILSSDLKLTLIDLFFKNLLLKTDNLNLSGNFSSKFIAQTP
FT                   RVDATLNISSLDLSGKSYPIISPIIRFTQNLTKDMQSLDYPSKFIPIRTIGYLANLDIL
FT                   IDSVKYNDHVFDKMNLLAKILPATIKISNLDFKTANSCLSTRWHLDTSSVLPSLTVEIK
FT                   DGYLTTDSFSLSSMLNLRNKLVNEYSLNNAILQFYGTLSTLSQNNFIFRNVKFYLANHN
FT                   NLLQFNNIEAELLGGKFQGSGNILLEPYSINFVYALNTVDLNKISALMYNIFTWSGGKG
FT                   SISGSLWTNGNSLKSQLYNLTTKSQFVINNIDVNNFGIDSFIEKINTSDYNVRNLDNDI
FT                   NSSITTGRTNIKDISGDIELQKGIILLKNIKFATQYSSGAASFAVNIYNFDIDSSSVLS
FT                   FYIPEKLVKLNNLHTNSDKASLAQLNIRMNGSIFEPKKTFDSSELKKILIPQTHYNKLT
FT                   IDNH"
     atgatcaaaa aaatagttgt cggaattata atttgttttg cattattatt tataattttt        60
     agtgtattat catttatgaa ctataatttg gtaactaata attttattaa tcatttcggc       120
     attgcaaggg aagatattag aaaaataaag atccataaat tccctttacc atatttatgt       180
     attgatacga taaaggaaga tggaaagtta gatctagagc agattaaaat ccatttttca       240
     ttgtggtcac ttataaaatt taatcctaaa attaataaaa tagacatatt agatgctaag       300
     ttttatgcaa atgctaatgt attcaatatt tataatcatg aagaattaat caagaatttc       360
     tttaaatata aattacaaaa tatcaatcta catattacga atttaagtat ttttaataaa       420
     caagactatt ctatcttaaa ttttaataat tgtgttttaa aaaaagcaaa tgctttatcc       480
     tctcattaca tatttaacac tactagtaac aatataggta gaatttcagg ttccattaat       540
     aaacgtgatg atatagtaga ttttagactt aatgttgata ataatgatta tggctctaag       600
     ttatcacagc tttataaaga ttttaagttt actagaggta caggtgaata tcagattaaa       660
     aatttagcat ctgtaatgta taatatatta ccagatttaa agcatctttt aaataaattt       720
     aatcaaactg agccagtgaa cattaaattt aatattgcaa ataatgaaga tgaaatagaa       780
     ctaaaagaca tagttataga atcatctttg attataggta atggctttgt taacattgct       840
     aaaaatacta atattactac taatgtgcaa ctaaatttcc ctaaaataga tctaaggtca       900
     ttaattttac caaacgcagt ggtaaaattt aatacttttg gttcaaatat tagatttatt       960
     tttgcggata aattacttaa agcaaatgtt gcaattaacg aaataatttt aagtaataat      1020
     gaagcgctag aaaaaatagt ctttgctgct aatttatcaa atggtacgtt aaacataaat      1080
     gaactttcag gtaatattaa gtctggtgga gagtttaggc ttacaggtaa tgtaacacag      1140
     aatgctgtta gaagtatgtt cgatggaaag ttatatttaa aacataatga tatgaattca      1200
     ttactgaata ttttaggatt taacaatctt accattcaag aatctgtacc ttttatcttg      1260
     tcatcagatt taaaacttac tttaatagat ttatttttta aaaatttatt acttaaaacg      1320
     gataatttaa atttatcagg aaatttttct agtaaattta ttgctcaaac acctcgtgta      1380
     gatgctacgc ttaatatatc ttcacttgac ttaagcggta agtcctatcc aataatttcg      1440
     cctattatta gatttacaca gaatttaact aaagatatgc aatctttaga ttatccgagt      1500
     aagtttattc ctattagaac aataggctat ttagctaatt tagatatttt gatagatagc      1560
     gttaagtata atgatcatgt atttgacaaa atgaatttgc ttgctaaaat cttacctgct      1620
     actatcaaga ttagtaattt agattttaaa actgctaata gctgtttatc gactagatgg      1680
     catttagaca cttcaagtgt attgccatct ttgactgtag aaattaagga tggttattta      1740
     actactgatt cattttcatt gagctcaatg cttaatttaa gaaataaatt agtaaatgaa      1800
     tatagtttaa ataatgctat attgcaattt tatggtacat tatcaacatt atcgcaaaat      1860
     aattttatat tcagaaatgt taaattttat ttagcaaatc ataataatct attacaattt      1920
     aataatattg aagcagaatt attaggtggt aagtttcaag gtagtggtaa tattttattg      1980
     gaaccttatt ctatcaattt cgtatatgct ttaaatacag tagatttaaa caaaatttcg      2040
     gctcttatgt ataacatatt tacttggagt ggtgggaaag gaagtataag tggtagttta      2100
     tggactaacg gtaatagcct taaaagtcag ctatataacc ttactacaaa atcgcaattt      2160
     gtgatcaaca atatagatgt taataatttt ggaattgatt cttttataga aaaaattaat      2220
     acatctgatt ataatgtacg aaatttagat aacgatataa atagttctat aaccacaggg      2280
     cgaaccaata ttaaagatat aagcggcgat attgaattac aaaaaggtat tattctttta      2340
     aagaacataa aatttgcaac acaatatagt agtggtgcag cttcttttgc agttaacata      2400
     tataattttg atatagattc ttctagtgtt ttatcatttt atattccaga aaagcttgtt      2460
     aaattaaata acttacatac aaattctgat aaagctagtt tagcgcagct taatataaga      2520
     atgaacggga gtatttttga gcctaagaaa acttttgata gtagtgagct aaaaaaaata      2580
     cttataccgc aaacacatta caacaaactt actatagata accattaa                   2628
//

If you have problems or comments...

PBIL Back to PBIL home page