(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE331

AE017197.PE331       Location/Qualifiers
FT   CDS_pept        complement(434960..435208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03821"
FT                   /db_xref="GOA:Q68X21"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68X21"
FT                   /protein_id="AAU03821.1"
FT                   /translation="MTKILLLTITFYKYFISPLLGNNCIFSPTCSEYAQEAIITHGIIK
FT                   GLWLTFRRIIKCQPFCIGGYDNVPTSIKNSKQPTKKI"
     atgactaaaa tacttttatt gacaataacc ttctataaat attttatttc tccgctactt        60
     ggtaataatt gcatattttc ccctacttgc tcagaatatg ctcaagaagc tataataaca       120
     catggcatca taaaaggctt atggcttacc tttagaagaa taatcaaatg ccaaccattt       180
     tgtattggtg gatatgataa tgttccaaca tctattaaaa attctaaaca acctactaaa       240
     aaaatatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page