(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE346

AE017197.PE346       Location/Qualifiers
FT   CDS_pept        450586..451326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0357"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03836"
FT                   /db_xref="GOA:Q68X06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q68X06"
FT                   /protein_id="AAU03836.1"
FT                   /translation="MKPYLYAEKIQFKVSERSDPIIFETTLNIAQEEFVVILGHNGSGK
FT                   STLAKILAGYLTPTSGQVFLDQVKVDKISQKHKALMLVTITQKLEDRLFTELTLEENIM
FT                   LWESRYHSNERLTSSDVLELTGSPKRFLPLLSQQLGKFSGGEKQVILLALSIAHPPKIL
FT                   FLDEHTANLDPKASLEVIKKTAEIIEHHKITAVMITHNLEAAAHYGKRLIVLDSGKVVL
FT                   DYLKPQNFSLRELRAILSSKIAGW"
     atgaaacctt atttatatgc agaaaaaata cagttcaaag ttagtgaaag aagtgatcct        60
     ataattttcg agactacttt aaatattgca caagaagagt ttgtggtaat attaggtcat       120
     aacggtagtg gtaaatctac tttagctaaa atacttgccg gttatttaac accgacaagc       180
     ggacaagtat tcttagatca agttaaagtt gataaaatat ctcaaaaaca caaagcactt       240
     atgcttgtta caataacaca aaagcttgaa gataggctat ttactgagtt aactcttgag       300
     gaaaatatta tgctttggga aagtagatac catagtaatg aacggttaac aagtagtgat       360
     gtattagagc ttacaggttc gcctaaacgc tttttacctt tactttcgca gcaactaggt       420
     aaattctcag gtggagaaaa gcaggttata ttgcttgcac ttagtatagc tcatccacct       480
     aaaatattat ttctagatga gcatacggct aatttagatc cgaaagcttc tttggaagtg       540
     ataaaaaaaa cagcagagat tatagagcat cataagataa ctgccgttat gattacgcat       600
     aatttggaag cggcagcaca ttatggcaaa aggcttatag tacttgatag tggtaaggta       660
     gtgctagact acctaaaacc acaaaatttt tctttaagag aacttagagc tatattatca       720
     tctaagatcg cagggtggta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page