(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE36

AE017197.PE36        Location/Qualifiers
FT   CDS_pept        complement(51017..51268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0039"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03526"
FT                   /db_xref="GOA:Q68XW6"
FT                   /db_xref="InterPro:IPR035116"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XW6"
FT                   /protein_id="AAU03526.1"
FT                   /translation="MFKNLLLSIIIFLGINQNVYSINSSSYKTDDIIKIVIILGIVALI
FT                   FSPAKLRIIVIGTILGLACAYFTYKYIVPIFIASLNGA"
     atgtttaaga acttattatt aagtataata atatttctag gtataaacca aaatgtttat        60
     tctataaact ctagctctta taaaacagat gatataatca aaatagtcat tattcttgga       120
     atagttgctt taatttttag tcctgcaaaa ttacgtataa ttgttatcgg tactatatta       180
     ggtttggctt gtgcatattt tacttataag tacatcgtac ctatttttat tgcttcacta       240
     aatggagcat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page