(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE378

AE017197.PE378       Location/Qualifiers
FT   CDS_pept        complement(492156..494750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03868"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WX4"
FT                   /protein_id="AAU03868.1"
FT                   /translation="MIARYSFLQNFAEYIIDKLKKGIEVQIILPNNLLCLKLKQILIDK
FT                   YKIKLPIIIPFNAIFFKKNESDYISKIEELFILSSIITEYKELPFNLEESLKSAEILRK
FT                   LFNDLIINNIDIKLIEVYNNSNYWQKIYKFLEICFLKWKKAISLTQKYTKTIHEFNILQ
FT                   EEIIKIKKRDKRIILAGIFKPNVFFKKFEEELKDYIIHYNPSYNYISNNISYSEPNNIY
FT                   EEAKQIAYICELNKDKHIAIVTNDNKLKKVYCNFLDQKYSDLLGNDLRRTNIGELLTAI
FT                   IKIICNNFDLKLLFLLLKNPLINCHSVQKLELMLSNQNRFISSPKYLLQLQFENEELKE
FT                   YCANLIDILFTNNPHNITGILTLTQEIAEKLLPTIWEKEEGEVLIEFLTNLISYSKHIN
FT                   LMNKKDFPKIFSFLLSNIKHYKNTDSSSIIIGQPEDLVLCRFDLIILPHFNNEHWSPNA
FT                   KPHPLLSKKALQILNIDYNDAITTMLYTDYFNLLLQNKQIVILNAKKYNGKLSTSCNLF
FT                   LRLQLKHVIPWFDPKLLTPATNSLDIKSQDDHKLTTISHSFPSVLSVTDIESLIRNPYG
FT                   FYAKKILGLYKKDNIWEEPKISDFGNFIHKVLEKYSKNYDKQYVCLNLLDKQAALINIG
FT                   NHILYSTILPAYTKKIWQIKLTAFSKTFILFDIERRKNCKEIYFEIKGELRLNIAGQNI
FT                   KIIGIADRIEVSKSNDITILDYKTGTIPTKKEIEFGLSPQLIIECLMLLENGFNIKSFS
FT                   NLETSQLSNIHIGRDTVICSRAQVVNPSYLKNYKSSCINKKLTIAYVRITSTEPYIQTT
FT                   EIDLNIETLHKHKAGLIRLLEYYVTNKSFSYDFNLSNYNDYRHLTRCYYINS"
     atgattgctc gttattcttt tttgcaaaat tttgctgagt atattattga taaattaaag        60
     aaaggtatag aagttcaaat aatattacct aataatttgt tatgtctaaa attaaagcag       120
     attttaatcg ataaatataa aattaaatta cctatcatta ttccttttaa tgctatcttt       180
     tttaaaaaaa atgaatcaga ttatatatct aaaatagagg aattatttat tttatcatcc       240
     attatcacgg aatataaaga attaccattt aatctcgaag aatcattaaa atctgcagaa       300
     atcttaagaa aattatttaa tgaccttata atcaataata ttgatatcaa attaattgaa       360
     gtctataaca attctaatta ttggcaaaag atttataaat ttctagaaat ttgcttttta       420
     aaatggaaaa aagcaatatc gcttactcaa aaatatacta aaacaataca tgaatttaat       480
     atactacaag aagaaatcat aaaaataaag aaaagagata aacgaataat actggctgga       540
     atattcaagc ctaatgtttt ttttaaaaaa tttgaagaag aattaaagga ttacataata       600
     cattataatc catcatataa ttatattagt aataatatat cttattctga acctaataat       660
     atttatgaag aagcaaaaca aatcgcttat atatgtgaac ttaataaaga taaacatatt       720
     gcaattgtta caaacgataa taagcttaaa aaagtatatt gtaatttttt agatcaaaaa       780
     tattcagacc tattaggtaa tgatttaagg cgtactaata taggggaatt actaactgca       840
     attattaaaa taatatgtaa taattttgat ttaaaacttc tatttttatt acttaaaaat       900
     cctttaatta actgccattc tgtgcaaaag ttagagttaa tgctatctaa tcaaaaccgt       960
     tttatatcat cgcctaaata tttattgcaa ttacaatttg agaatgaaga actcaaagag      1020
     tattgcgcta acttaataga tattttattt acaaataacc cgcataatat aacaggtatt      1080
     ttaaccttaa ctcaagagat agctgaaaaa cttttaccta ctatttggga aaaagaagaa      1140
     ggtgaagtac taattgaatt tttaacaaat ttaatctcat atagcaaaca tataaattta      1200
     atgaataaaa aagatttccc taaaattttt tcttttttac tatctaatat caaacattat      1260
     aaaaatactg actcttctag tattattata ggacaacctg aagatttagt attatgtaga      1320
     tttgacttaa ttatattacc gcattttaat aatgaacact ggtcccctaa cgctaaaccg      1380
     cacccattgc ttagcaaaaa agccttacaa atactaaata tagattacaa tgatgcaata      1440
     actactatgc tatatacaga ttacttcaat ttattactac aaaataagca aatagttata      1500
     ctaaacgcta aaaaatataa tggcaagttg tctacctcat gtaatttatt tttgaggcta      1560
     caacttaaac atgtcatacc gtggtttgac ccaaaattac tcactcctgc tacaaactca      1620
     ctagatatca aatcacagga tgatcataaa ctcacaacca ttagtcactc ctttccaagt      1680
     gtcttatcag taaccgatat agaatcatta ataagaaacc catacggttt ttatgctaag      1740
     aaaatacttg ggttatataa aaaagataac atatgggaag aacctaaaat atcagatttt      1800
     ggtaatttta ttcataaagt tttagaaaaa tattctaaaa attacgacaa acaatatgtg      1860
     tgtttaaatt tgcttgataa acaagctgct ttaataaata tcgggaatca tattttatac      1920
     agcactattt taccagcgta tacaaaaaaa atttggcaaa taaaacttac agcgtttagt      1980
     aaaactttta ttctatttga tatagaacgc agaaaaaatt gcaaagaaat ctattttgaa      2040
     attaaaggtg aattacgtct aaatattgca ggtcaaaata taaaaataat cggtatagca      2100
     gatagaattg aagttagtaa atcaaacgat ataactatac tagattataa aactggcact      2160
     atcccaacta aaaaagaaat agagtttgga ctctctcctc agcttattat cgaatgttta      2220
     atgttactag aaaatggatt caatataaag tcattcagca atcttgagac aagtcaattg      2280
     tctaatattc acattggcag agatacggtc atatgctcta gagcacaagt tgtcaatcca      2340
     tcttatctaa agaattataa atctagctgt ataaataaaa aactcaccat tgcctatgta      2400
     agaatcacta gtacggaacc atatatacaa acaacagaaa tagacttaaa cattgaaact      2460
     ttacataaac ataaagcagg attaataaga ctactcgaat attacgttac caacaagtcc      2520
     ttttcttatg attttaattt atcaaactat aatgattata ggcatttgac tcgatgttat      2580
     tacattaatt cttaa                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page