(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE379

AE017197.PE379       Location/Qualifiers
FT   CDS_pept        complement(495171..496010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0392"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03869"
FT                   /db_xref="GOA:Q68WX3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX3"
FT                   /protein_id="AAU03869.1"
FT                   /translation="MQEKPIIGITPDLAKNCQKYTYADFPWYALRRNYADAIIAAGGIP
FT                   VLLPYQSDTINELMELINGIVIPGGDEDIHPKFYEQKYAEDLVISNEERDHFEILVLKK
FT                   ALEKDMPVLGICRGMQLLNVMFKGTLIKHIPDYIKHFSKLTYRKKFESKTEAFATKVYT
FT                   LPIKLEFDHEPIETIINHIQPAPKNIVSHAINIEVNTKLSKIANNCLQTMVNSTHHQAI
FT                   KKLGNDLIISAKAEDGIVEAIEATKHKFVIGVQWHPEYMNDNGVDLQLFKALVKASK"
     atgcaagaga aaccaattat aggtataaca cctgatttag ctaaaaattg tcaaaaatat        60
     acttacgctg attttccatg gtacgccttg cgacgcaact atgccgatgc gattattgca       120
     gctggtggta taccggtatt attaccttat caaagtgata caataaatga gctaatggaa       180
     cttattaatg gtattgtaat tccaggtggt gatgaagata tacatcctaa attttatgag       240
     caaaaatatg ctgaagattt agtaatttct aatgaagaac gtgatcattt tgagatatta       300
     gttttaaaaa aagcattaga gaaagatatg cctgttttag gaatatgccg cggtatgcag       360
     ttattaaatg ttatgtttaa gggcacactt attaaacata ttcctgacta tattaaacat       420
     ttttctaaac taacgtatcg aaaaaaattt gaaagcaaaa ctgaagcatt tgcaactaaa       480
     gtgtacacat taccaataaa attagagttt gatcatgaac ctattgaaac tataattaac       540
     catatacaac ctgcacctaa aaacatagtt tcacatgcaa ttaatataga agtaaatact       600
     aaactttcta aaatagctaa taactgttta caaactatgg ttaattcaac tcatcatcag       660
     gctattaaaa aacttggtaa tgatcttatt atatcggcaa aagcagaaga tggtatagtg       720
     gaagcaattg aagcgacaaa acataaattt gttatcggcg tacaatggca tcctgaatat       780
     atgaatgata atggagtaga tttacaatta tttaaagcac tagtaaaagc tagtaagtaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page