(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE380

AE017197.PE380       Location/Qualifiers
FT   CDS_pept        499359..500723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03870"
FT                   /db_xref="GOA:Q68WX2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WX2"
FT                   /protein_id="AAU03870.1"
FT                   /translation="MNDTILYGFNVQSSFISARLKKIFTPAFFLSLLLFIGLVFFVSFA
FT                   INNYVNDTLSITLVQPDSSEEETISFKEVVVKKGDTIKSILVEQKIPKNDIEKIINLVK
FT                   AGQLSSTLKIGQQITFEYETKITENDDEDLTSEITFLNKIIIIIDKLKTVEVIREGDNF
FT                   KVEEIVVPLSKKVSKSSVNIESNFMSALKKLGLSNNSIIELINAYAYQIDFQRQIKNGD
FT                   TATVITEKYITEDGKFSHHGKILYVSLNLSGKEYNIYRYSHDNNANNYAFFSEDGKSVK
FT                   RSLLKTPLKVIKVSSHYGNRKHPILGYTKMHRGVDFAAPTGTPIYSAGNGVITEIGWKS
FT                   GYGKFIQVKHSGTLSTAYAHASSFAKNLKVGSIVKQGQVIAYVGSTGRASGPHLHYEVK
FT                   IDGKHVNPMSVKTTPGIELNGKNLEKFKQFKQEIKTLNVKLDKESYTDEINTVSL"
     atgaatgata ccatactata tggttttaat gtacaatcat cttttattag tgcacgttta        60
     aagaaaatct ttactcctgc atttttcttg tcattgttat tatttatagg tttagttttt       120
     tttgtatctt ttgcaattaa taattatgtg aatgatacct tatccataac tttagtacag       180
     ccggatagta gtgaagaaga aacaatttca tttaaagaag tagtagtaaa aaaaggtgat       240
     actataaaat caattttggt agaacaaaaa atccctaaaa atgatataga aaaaattata       300
     aatttagtaa aagcaggtca attatcttcc actcttaaaa taggtcagca aattactttt       360
     gaatatgaaa caaaaattac cgaaaacgat gatgaggatt taacttcaga gataacattc       420
     ttaaataaaa ttattataat tattgataag ctaaaaactg ttgaagtaat tagagaaggc       480
     gataatttta aagttgaaga aattgtagta cctttaagta aaaaagtttc taaatcatct       540
     gtaaatattg aatcaaattt tatgtcagct cttaaaaagc ttggtttatc aaataatagt       600
     ataatagagt taattaatgc ttatgcttat caaatcgatt ttcagcgtca aataaaaaac       660
     ggtgatactg caacagtaat aacagaaaaa tatataactg aagacggtaa attttctcat       720
     catggtaaaa ttctatatgt ttcattaaat ctttcaggga aagaatataa tatatatcgc       780
     tattcacatg ataataatgc gaataattat gcattttttt ctgaagatgg taaaagtgta       840
     aaaagaagct tacttaaaac tccgctaaaa gtgataaaag tttcttcaca ttatggtaat       900
     agaaaacatc caatactcgg ttatactaaa atgcatagag gtgttgattt tgcagctcca       960
     accggaacac ctatatattc tgctggaaac ggtgttataa cggagatagg ttggaaatca      1020
     ggttatggaa aatttattca agtaaaacat agtggtacac tatctactgc ctatgctcat      1080
     gcttcaagtt ttgcaaaaaa tttaaaagta ggaagtatag taaaacaggg gcaagttata      1140
     gcatatgttg gtagtacagg tagagctagt ggaccgcatt tacattatga agtaaaaatt      1200
     gatggcaaac atgtgaatcc tatgtcagtt aaaacaacac ctggtataga attaaacggc      1260
     aaaaatttag aaaaatttaa acaatttaaa caagaaataa aaactttaaa tgtgaagctt      1320
     gataaggagt cgtatactga tgagataaac acagtgtctt tatga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page