(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE413

AE017197.PE413       Location/Qualifiers
FT   CDS_pept        535490..536665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0426"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03903"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WT9"
FT                   /protein_id="AAU03903.1"
FT                   /translation="MQDFNVESRSVLHMTAQIRAKQLAIRDAQNREQNAIVKTWEENGV
FT                   DTSDEAVSNRIINSLEFFYNTSKALSDYLKTQDINNVGYPITFNKTALQLKMALNYAKQ
FT                   QEDNLIDQIIKGKFYNGLSNDINSQELPVLQSNNMLSFWGNENSSVSSVLLASIARILD
FT                   IEFVPLVGAATNYKFYNPEYTLPQELIPEDYYFASKEGMLLFGDYQYGGHRAFEEQLVF
FT                   GPEDCSSSVGKATYLSNQQTRSITTTQMKENYSKYNYKLITLLKDIVEQKQLELIEPGD
FT                   LYVYKNHCAIIATKPDNKAEVTTLQFSRNIDRVENKVSGGGICNYNLIDKAQEEPVNPI
FT                   YILRKNLEPLPSQSSLKYFLSTIDEGYLNLYPDGPSENVVGDCRMFFETQE"
     atgcaagatt ttaatgttga atcacgatca gtgcttcaca tgacagctca aattagagct        60
     aaacaattag caattagaga tgcgcaaaat agagagcaga acgctatagt taagacatgg       120
     gaagaaaatg gcgttgatac aagcgatgag gcagtaagca atcgcattat aaactcttta       180
     gagttttttt ataacacaag taaagcatta agtgactatt taaaaaccca agatatcaat       240
     aatgttggtt accctataac atttaataaa actgctctgc agttaaaaat ggcattaaat       300
     tatgcaaagc agcaagagga taatttaata gatcaaataa ttaaagggaa gttttataat       360
     ggtttatcaa atgatataaa ttctcaagaa ttacctgttt tacaatccaa taacatgcta       420
     tctttttggg gtaatgaaaa ctcttctgtt agttctgtat tgcttgcaag cattgctcga       480
     atacttgata tcgagtttgt accattggta ggagctgcaa ccaattataa attttataat       540
     cctgaatata cgctaccgca ggaattaata ccggaagatt attattttgc ttccaaagaa       600
     ggaatgttac tttttggaga ttatcaatat ggtggacatc gtgcttttga agagcaatta       660
     gtgtttggac ctgaagattg ttcaagtagt gttggtaagg cgacttattt atctaaccaa       720
     cagacaagaa gtataactac cactcaaatg aaagaaaatt attctaaata taattataag       780
     ttaattaccc ttttaaagga tatagtagaa caaaaacaat tagaattaat tgagcctggt       840
     gatctttatg tttataaaaa tcattgtgca attattgcta ctaaacccga caataaagca       900
     gaggttacta cactacaatt ttcaaggaat atagatagag tagaaaacaa ggtgtctggt       960
     ggcggcattt gtaattacaa cttaattgat aaagctcaag aagaaccagt gaatccaatt      1020
     tatatcttac gtaaaaattt agaaccatta ccttcgcaat catcgttaaa atatttttta      1080
     agcacaatcg atgaagggta tctaaattta tatcctgatg gtcctagtga aaacgttgta      1140
     ggagactgta gaatgttttt tgaaacccaa gagtaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page