(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE428

AE017197.PE428       Location/Qualifiers
FT   CDS_pept        complement(567565..568323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03918"
FT                   /db_xref="GOA:Q68WS4"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WS4"
FT                   /protein_id="AAU03918.1"
FT                   /translation="MSGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNVPE
FT                   NNPRLRKALNAARSQNLPKERIDKAINSANDASNTESYTEIRYEGYAPNGIAIIIEALT
FT                   DNKNRTASEVRSSFTKYGGILGETGSVNYLFNHCGVIQYPINIASNEDIFEAAIEAGGN
FT                   DIISNDFAHTIYTDIENFYKALGFLTDKYGIPEDSYIGWIPVNTIIIDDKEKAKKLLKL
FT                   IEVLEENDDVQRVFGNYMLSEDVYEIIQEE"
     atgtccggtc actcaaaatt taagaatatt cagcatcgta aaggtgctca agataaaaag        60
     aaatcaaaag tttttactaa attaattcgt gaaatagtga ctgcagttaa aacaggcgct       120
     tctaatgttc ctgaaaataa tccacgtctc aggaaggctt taaatgctgc acgcagtcaa       180
     aatctcccta aagaaagaat agataaagct attaatagtg ctaatgatgc ttctaatact       240
     gaaagttata cggaaattag atacgagggt tatgcaccaa atggtattgc tataataatt       300
     gaagctttaa ccgataataa aaaccgtact gcttcagaag tgcgatctag tttcactaag       360
     tatggcggaa tattaggaga aaccggtagt gtaaattatt tatttaatca ttgtggagtt       420
     attcaatatc caataaatat agcatcgaat gaagatattt ttgaagcagc gatagaagct       480
     ggagggaatg atattatatc aaatgatttc gcacatacaa tatatacgga tattgaaaat       540
     ttttataaag ctctaggatt tctaaccgac aaatacggca tacctgaaga ctcttatata       600
     ggctggatcc cagtaaatac tataattata gatgataaag aaaaagctaa aaaattacta       660
     aagctcatag aagttttaga agaaaatgat gatgtacaaa gagttttcgg taattatatg       720
     ttatcggagg atgtttatga aataatacaa gaggaataa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page