(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE431

AE017197.PE431       Location/Qualifiers
FT   CDS_pept        569537..570028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0445"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03921"
FT                   /db_xref="InterPro:IPR024386"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WS1"
FT                   /protein_id="AAU03921.1"
FT                   /translation="MNIKLVIYFLILVNSLKVNADLNHIQDSFEYQKEQLAIELPWSDC
FT                   TAIHKFLEEKLFFSEQQIKKENKIHEKYKQFYLQYNNKLSDFSMHFLDKNTEINGVETL
FT                   ISGFLKFCEDNFQTNKSKTNFLNFFQKQQDQWLHNIRNENYKTHYRKNMKIIPLEKLTN
FT                   "
     atgaatatta aattagtgat atatttttta atattagtaa attcattaaa agtaaatgct        60
     gatttgaatc atattcaaga tagttttgaa tatcaaaaag aacagttagc aatagaattg       120
     ccttggagtg attgtactgc aattcataaa tttttagaag aaaaattatt tttttcagaa       180
     caacaaataa aaaaagaaaa taaaattcat gagaaatata agcaatttta tttacaatat       240
     aataataagc tttctgattt ttctatgcat tttctagaca aaaacactga aattaatggt       300
     gtagaaactt taatatcagg ttttttaaaa ttttgtgaag ataattttca aactaataaa       360
     agtaaaacta atttcttaaa ttttttccaa aaacaacaag accaatggtt gcataatata       420
     agaaatgaga attataaaac acattatagg aaaaatatga agataatacc tttagaaaaa       480
     ttaactaatt ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page