(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE436

AE017197.PE436       Location/Qualifiers
FT   CDS_pept        complement(575827..576618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03926"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WR6"
FT                   /protein_id="AAU03926.1"
FT                   /translation="MSDLVANLKKNGLEPQHFDDVLYIQKEINKDSDFIEVFFFPFGCV
FT                   TIWGGDEIQEKIILSNTDLVAVNKLKEHLSDYIYFEYNTDVEKTFIDEEKNKIILADKS
FT                   IFVKLSISHALAQSVKLSVLEQSVSNLIVQTTPIQQELARTGSVSLSKKEILQQIGILF
FT                   NERYSISLHSDIFDTPEFFWRRPNYEPLYLMTAEFQDIEIRQNIMNHRLNMIQELLDIL
FT                   SNDLNYKHSTKLEWIIIILIGLEVILSLSHTNLFLKIIGAL"
     atgagtgatt tagtggctaa tttaaaaaaa aatggtcttg aacctcaaca ttttgatgat        60
     gttttatata ttcagaaaga gataaataaa gattctgatt ttatagaggt atttttcttt       120
     ccatttggat gtgtaactat ttggggcggt gatgaaattc aagaaaaaat aattttaagc       180
     aatactgatt tagtggcagt aaataaactt aaagagcatc tatctgatta tatttatttt       240
     gaatataata ctgatgtcga aaaaactttt attgacgaag aaaaaaataa aattattcta       300
     gctgataaat ctatttttgt taaactttct atttcgcatg ctttagccca atcagttaaa       360
     cttagcgttc ttgagcaatc agtgagtaat ttaattgttc agacaacccc tattcagcag       420
     gaactagcta gaacaggaag cgtatcatta tctaaaaaag agatattaca gcaaataggt       480
     atattattta atgaacgtta ttcgattagt ctacatagtg atatattcga tactcccgaa       540
     ttcttttggc gtcgtcctaa ctatgagcct ttatatctta tgacagcaga atttcaagat       600
     atagaaatac gacaaaatat aatgaatcat cgtcttaata tgattcaaga gcttttagac       660
     attctttcaa atgatcttaa ttataaacat tccacaaaac ttgaatggat tattattatt       720
     ttaatcggtc ttgaagtgat tctatcatta tctcatacta atcttttttt aaaaattatc       780
     ggagctttat aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page