(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE444

AE017197.PE444       Location/Qualifiers
FT   CDS_pept        complement(588509..589513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0459"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03934"
FT                   /db_xref="GOA:Q68WQ8"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WQ8"
FT                   /protein_id="AAU03934.1"
FT                   /translation="MFRLLLISITFLVLYSGFTFIEHFNSKVVISLYNYNIETTLFLSV
FT                   ILELLLLVFCFIIIRFLIIIIDLPATIHNIFSKRKINHDRHALILAFAEYIIGNKMKAA
FT                   SIARKNLSSDDLKDFQKFYNFILAITADDIDSKIFYFQKLITSKEFIFYASKNLAKLYY
FT                   DKSLYDKAENYAIKAYNLNKLDSDNLIILMHCYAKLSLWTKFIFITNKLAKFHKHEFIP
FT                   KITQYYLLIAKQEVNSNNTANAIDYLEKAIDLNFYNDELLEFYFNLNDKLSVDQKTKIL
FT                   KKAFRITPSLRLVQLFKKITSLSDKQIYEELIQVLDTKKDKIFILAIESYLEL"
     atgtttaggt tattattaat atctattact tttttagtgc tatattccgg atttactttt        60
     atagagcact ttaattcaaa agttgtcatt agtttatata attataatat tgaaactact       120
     ttattcttga gcgttatttt agaattatta ctattagtat tttgttttat tattattaga       180
     tttctaatca taattatcga tttaccagct acaatacata atatttttag taaacgaaaa       240
     attaatcatg atagacatgc tttaattttg gcttttgcag aatatattat aggtaataag       300
     atgaaagctg catctatagc acgcaaaaat ttatcttctg atgatctaaa agattttcaa       360
     aaattctata attttatctt agccataact gcagatgata tcgatagtaa aattttttat       420
     tttcaaaaac ttattacgtc taaagaattt attttttacg ccagcaaaaa ccttgcaaaa       480
     ctttattatg ataaatcttt gtacgataaa gcagaaaatt atgcgataaa agcttataat       540
     ttaaataaac ttgatagtga caatttaatt atcttaatgc attgttatgc taaactttct       600
     ttatggacaa aatttatttt tataacaaat aaactagcaa aatttcataa acatgaattt       660
     ataccaaaaa ttactcagta ttatctatta atcgcgaagc aagaagtgaa cagtaataat       720
     actgctaatg ctatagatta tttggaaaaa gctatagatt taaattttta taatgacgaa       780
     ttactagaat tttattttaa tttaaatgat aagttaagtg ttgatcaaaa gactaaaata       840
     ttaaaaaaag ctttccgtat taccccttct ttaagattag tgcagctatt taaaaaaatc       900
     acttctctat cagataagca aatttacgaa gaattaattc aagtattaga tacgaaaaaa       960
     gacaaaatat tcattttggc aatagaatct tatttagaat tgtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page