(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE463

AE017197.PE463       Location/Qualifiers
FT   CDS_pept        complement(614683..615405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03953"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN9"
FT                   /protein_id="AAU03953.1"
FT                   /translation="MERLIHKSVYYKIFDKTFNNSSHRYIQKNYSIYDAEIVANIESIT
FT                   NYFKAQDILILNQVHSNQIVNADEHIMTIPEADGSITTKKNLVLTVQSADCVPVLLASD
FT                   DGKIIGAAHAGWQGSINNIISNIVTKMVETGAKNLIAVIGPAIAQSSYEVDDKYYKTFL
FT                   SKDINNKQFFINSIKENHYMFDLPAFVEFKLNESGVKDIKNLTEDTYTNPFKYPSKRRS
FT                   YHMQVPYNEKILSAIVIK"
     atggaaagat taatacataa atcagtttat tataaaattt ttgataaaac attcaacaac        60
     tcgagtcata gatatataca aaaaaattac tctatatatg acgcagaaat agtggcaaac       120
     atagaatcta ttactaatta ttttaaagca caagatattt taattttaaa tcaagtacat       180
     agcaatcaaa ttgttaatgc tgatgagcat ataatgacta tacctgaagc agatggaagc       240
     attacaacta agaaaaattt agtattaaca gtacaatccg cagattgtgt gccggtatta       300
     cttgcaagcg atgacggtaa aataatagga gctgcacatg caggttggca aggaagtata       360
     aataatatta ttagtaatat agtgactaaa atggttgaaa caggagccaa gaatttaata       420
     gcagtgatag gtccagctat agcacaaagt tcatatgaag ttgatgataa atattataaa       480
     actttcttaa gtaaggatat taacaacaaa caatttttta taaactcaat aaaagaaaat       540
     cattatatgt ttgatttacc agcttttgta gaattcaagc ttaatgaatc aggtgtgaaa       600
     gatataaaaa atcttactga agatacttat acaaacccat ttaaatatcc aagcaaaaga       660
     cgctcatatc atatgcaagt accttataat gaaaaaatat tatcagctat cgtaattaaa       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page