(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE464

AE017197.PE464       Location/Qualifiers
FT   CDS_pept        615404..616234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03954"
FT                   /db_xref="GOA:Q68WN8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN8"
FT                   /protein_id="AAU03954.1"
FT                   /translation="MKIPYINYNNFINTLSNNLQKNKQLEKIIEQFYQDYQLIPIIGVE
FT                   IEFYLSNNIDIANFEILSREYLSKFKISKIKKEKGNNQFEIALPPSINLIQYIKNILEV
FT                   KKILKKSAKQLNGYIDFSPKPFLDDYGNSMHFHINFNSELHDYYILAAQGICHYMLDTL
FT                   LVFMPTTLDYLRINKKFMSPTHVSYGGNNRSVAVRTPNSLPKRLEHRLSSPETDPYIAM
FT                   FTILKSILLALTFPNSIKKIEKIYGNAFDPQYNLTPLPTSFQESSMLFKPEFFT"
     atgaagatac catatattaa ttataataat tttattaata ctttatctaa caatttacaa        60
     aaaaataaac agttagaaaa aataatagaa caattttatc aagactatca gctcatccct       120
     attataggcg tagaaataga gttttattta agtaacaata ttgatatagc taactttgaa       180
     atactttcac gcgaatactt atctaaattt aaaatttcta aaatcaaaaa agaaaaagga       240
     aataaccaat ttgaaatagc acttcctcct tctataaatt taatacaata tatcaaaaat       300
     atattagagg ttaaaaagat tttaaaaaaa agtgcaaagc agttaaacgg ttatatagat       360
     ttttctccta agccgttttt ggatgattat ggtaatagta tgcattttca tattaatttt       420
     aattctgaat tacatgatta ttatatattg gcagcacaag ggatatgtca ctatatgcta       480
     gatacactac tagtttttat gcctactact ttagattatt tacggataaa taaaaaattt       540
     atgtctccta cgcatgtatc atatggtggt aataatagaa gcgtagccgt acggactcca       600
     aattctttac caaaacgttt agaacatcgc ttatcttctc ctgaaactga tccatatata       660
     gcaatgttta ctattttaaa gtcaatattg ttagctttaa cttttccaaa ttccatcaaa       720
     aaaatagaaa aaatttacgg taatgctttc gatcctcaat ataatttaac tccattacct       780
     acatcattcc aggagagttc tatgttattt aaaccagaat tttttacata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page