(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE465

AE017197.PE465       Location/Qualifiers
FT   CDS_pept        complement(616338..617183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03955"
FT                   /db_xref="GOA:Q68WN7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN7"
FT                   /protein_id="AAU03955.1"
FT                   /translation="MIMRKILNCLYVALFRTIKDDGVEHSGYMSFMILLSIFPFLVFLL
FT                   ALTSFLGASELGQNFIQIFLESLPEQATESIEKRIRELLSAPPQSLMNLAIIGSIWTAS
FT                   SFVECLRTILNRVYQIKSPPPYIRRRLLSIIQFLIISALITFTMFLLVVIPIIFTKIPI
FT                   ILETIEQYKIILNFIRYSLILILLFLGASSLYYILPNVKLNFVDVFPGAVLTVVLWIIS
FT                   GYLLSTYIVYYNQLNLMYGSLGSIIVTLIFFYIINMIFIYGAEFNYLMQNYANVEQSAA
FT                   "
     atgataatga gaaaaatttt aaattgtctt tatgtagctt tatttagaac aataaaagat        60
     gatggcgttg aacattctgg atatatgtca tttatgatac ttttatctat tttccctttc       120
     ttagtattct tattagcttt aacaagcttt ttaggtgctt cagaacttgg tcaaaatttt       180
     atacaaattt ttctagaaag tcttccggaa caagcaacgg aatcaataga aaaaagaata       240
     cgagaattac taagtgctcc tcctcaaagt ttaatgaatc ttgcaatcat aggcagtatt       300
     tggactgctt cttcttttgt ggaatgttta aggactattt taaatcgtgt atatcaaatt       360
     aaatctccac caccttatat aagaagaaga ttacttagta tcatacaatt tcttataatt       420
     agtgccttaa ttacctttac tatgtttctt ttagtcgtga ttccaataat attcacaaaa       480
     ataccaataa tattagagac cattgaacaa tataagatca ttttaaattt tataagatat       540
     tctttaattt taattttatt atttttaggc gcatcatctt tgtattatat attacctaat       600
     gtaaaactaa attttgttga tgtatttcca ggagctgtat taactgtagt attatggata       660
     atcagtgggt atttactttc aacatatata gtatactata atcaactaaa tctcatgtat       720
     ggttcccttg gaagtataat cgtgacatta atatttttct atattataaa tatgatattt       780
     atttatggtg cagaatttaa ttatctaatg caaaattatg caaatgtaga gcaaagtgcg       840
     gcttaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page