(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE472

AE017197.PE472       Location/Qualifiers
FT   CDS_pept        626956..627915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0490"
FT                   /product="sugar isomerase protein KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:RT0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03962"
FT                   /db_xref="GOA:Q68WN0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WN0"
FT                   /protein_id="AAU03962.1"
FT                   /translation="MINTNNYHIIAKRIISNAANALDKLSNNIPADFNRIIEFLLSFKG
FT                   RIILTGIGKSGYIARKIAASFSSTGMPSFYLHPSEASHGDLGTITRNDLVMMLSNSGET
FT                   KELFNIIEYCNNSSIKIAAMTMNKNSTLAKRSDFLLIIPECQEASLIGAPTISSLIMLS
FT                   LGDAVMTVIHEERGFTRDDFKIYHPGGTIGANLTKIKNIMRSGDEIPLVYEDTSFTETI
FT                   IIMNKKRLGCTLVTDKEQNLIGIITDGDLRRNINDQIHLKTASSIMTKNPHHISSGIFA
FT                   QEALNLMKAKNITNIPIVDNNMIIGIIHIHDLLRMGVS"
     atgatcaata caaataatta ccacattatc gcaaagagga ttatttctaa tgcagcaaat        60
     gctttagata aattatccaa caatattcct gcagacttta acagaattat agaattttta       120
     ctatctttta agggacggat aattttaaca ggtataggca aaagcggtta tattgcaagg       180
     aaaatagctg ctagtttttc ttcaaccggt atgccttcct tttatttaca tccttcagaa       240
     gcaagtcatg gtgatttagg tacgataaca agaaatgatc tagtaatgat gttatctaat       300
     tctggtgaaa ctaaagaact atttaatata attgaatatt gtaacaactc ttcgataaaa       360
     attgccgcaa tgacaatgaa taaaaattcc actttagcta aaagaagtga ttttttatta       420
     ataatacctg aatgtcagga ggcttcatta attggtgccc ctactatctc atctttaata       480
     atgttatcac tcggcgatgc tgtcatgact gttatacatg aagaacgagg ctttactaga       540
     gatgatttta aaatttatca tccaggtggt acaataggtg cgaatttaac aaaaattaaa       600
     aatataatgc gtagtggtga tgaaatacct ttagtatacg aagatacttc atttaccgaa       660
     actatcatta ttatgaataa aaaacggtta ggttgtactc ttgttacaga taaagaacaa       720
     aatttgatag ggattatcac agatggtgat ttacgtcgta atattaacga tcaaatccat       780
     ttaaaaacag catcaagcat tatgaccaaa aatcctcatc atatctcatc gggaatattt       840
     gcacaagagg ctttaaattt aatgaaagca aaaaatatca ctaatatacc gattgttgat       900
     aataatatga ttataggcat tattcatatt catgatttac tcagaatggg agttagttaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page