(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE474

AE017197.PE474       Location/Qualifiers
FT   CDS_pept        628493..628924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0492"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03964"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM8"
FT                   /protein_id="AAU03964.1"
FT                   /translation="MSLQSSIYRIIKLIIFLTVNISIASAKDTNLQITANTLIIDRIKQ
FT                   KAEYSGNVIIYFDNAILKTQKLYIFYKTIAEKKIIEHIVVPTKLTVERKINNELLLADS
FT                   AKYFFVDKQLILLGNVILQRNDHVLKTNKLIYYVEIVRK"
     atgtctctac aatcatcgat ttatcggatt attaaactta taatatttct tactgttaat        60
     atatctattg ctagtgctaa agatacaaat ttacaaatta ctgctaatac tttaattatt       120
     gatagaataa aacaaaaggc agaatattct ggaaatgtca ttatttactt cgataatgcg       180
     atacttaaaa cgcaaaaatt atatattttt tataaaacaa tagctgaaaa gaaaattatt       240
     gaacatatag ttgttcctac caaattgact gtagaaagaa aaataaataa tgaattatta       300
     cttgcagata gtgctaaata tttttttgtt gataaacaac ttattctact tggtaatgta       360
     atattacaac gcaacgatca tgttttaaaa actaataaac taatctacta tgtagagatt       420
     gttagaaaat ag                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page