(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE478

AE017197.PE478       Location/Qualifiers
FT   CDS_pept        complement(633560..636421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0496"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03968"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM4"
FT                   /protein_id="AAU03968.1"
FT                   /translation="MAATNNKNYQKVVEKVLSSSKANKALKSAIKDLSSSNSISLRTIL
FT                   LGAKFILTHPVNTYNLVKLAKSSNIYLGSEFQKSLLENSPIWEFLKKHSDDLPKIGRIL
FT                   AKAGFREFQDKSALDEEGLKILKECFKNEKVLNKLQDIAVELKQELTDWNKVTSNILDM
FT                   LVTDKNFQKFFNAKSKDITHYIRTGVTEILPSDYIKSFDDILQKPEKKKLLKIFNTHPD
FT                   VKQELVNNINNPNILKKFNKLFYEQEIILSSFLKEVKAQSKPFLQEYFESYKIDLKILD
FT                   IIPTLLNKIPEIKEIFDTLNDPNQGVMISLEKALAMVAGDDQLKNFFANNKTILPNIAL
FT                   GIIENTPSVQNITKEYNFDKQMLIIVGEVMSKPEIAYEIITDLNKGDYMSLTGNIISII
FT                   NDPSFKLKDILVEQSKKGLFDNLINGVLAQDEKNSQIIKQQLINYGMEASDVTKLTRIM
FT                   PILLDKPESLKNVFRDFIKGNYTQMTKELIVLTKDNPEIKEYLNNNRTIFANILDKTLS
FT                   DIPGINNLDKQELYNVLPSMLNYPGELVKIIEEVEKSNYHGAISAIYDLAQKTNYFEGQ
FT                   LPNIIKAGFNSGFNYATEKVKDIFSSSQDFKDKAIDEITIRTNLDKIRNRKFNLEGAIL
FT                   SGNLSNIDFSGVSLKNADLTQVTSLRDCNFKNTNLVDAKLPDNLIIFTDTYNLDKTIPT
FT                   LAPKLIKAQQAKLVDKAIDKVFVQIKAEDKRNLVSKKEFVQQVKILLEENQIVKDYIID
FT                   KLNSLPMNMVTNLETPKINQYKHITNHVNSPFQILNPLYENIANQQDIKSNLFANILSE
FT                   KISKKLFDKGDNRGEDFYLINQMLKSIVAEYSKPNQNNIDNFLEHQNLEKLASNIASTF
FT                   YSKSKYTLLGTITSGIYLPKEIFNEQLKDNLKNEFKKINTSDVLKEAKSIVSNLDSKVH
FT                   IVDNKNKSHTYKSVLTKNQKIHR"
     atggctgcca caaataataa aaattatcaa aaagttgtag aaaaagtttt atcttcatct        60
     aaagctaata aagcactaaa gagtgcaatt aaagatttat catcttcaaa tagtatcagc       120
     ttaagaacga tcttactcgg agcaaagttt attttaactc atcctgtgaa tacttataat       180
     cttgtcaagc ttgctaagtc atctaatata tatctgggtt cagaattcca aaaatcactt       240
     cttgaaaatt ctccaatatg ggaattttta aaaaaacatt cagatgattt accgaaaata       300
     ggtcgcatct tagcaaaagc aggttttaga gaatttcaag ataagagtgc tttagatgaa       360
     gaaggactca aaatactgaa agaatgtttt aaaaatgaaa aagtacttaa caaacttcaa       420
     gatattgcag ttgaactaaa gcaagagcta acagactgga ataaagtaac ttctaacatt       480
     ttagatatgt tggttaccga taaaaatttc caaaaatttt ttaatgccaa gagcaaagat       540
     attactcatt atatacgtac cggagtaact gaaatacttc caagtgatta tatcaaatct       600
     tttgatgata tattacaaaa accagaaaag aaaaaattat taaaaatatt taatacacat       660
     cctgatgtta aacaagaatt agtaaataat ataaacaatc ctaatattct aaaaaagttt       720
     aataaattat tctatgaaca agaaataata ctttcaagtt tcctaaaaga agtaaaggca       780
     caatctaaac ctttcttaca agaatatttt gaaagttaca aaatcgatct taaaatttta       840
     gatattattc ctactttatt aaataaaatt cctgagataa aagaaatttt tgatactctt       900
     aatgatccaa atcaaggtgt catgatatct cttgaaaaag ccttagcaat ggtagctggt       960
     gatgatcaat taaaaaattt ttttgctaat aataaaacaa tattaccaaa tattgcttta      1020
     gggattattg aaaatactcc tagcgtacaa aacataacaa aagaatataa ttttgataaa      1080
     caaatgctta ttatagtagg cgaagtgatg tcaaagccag aaattgctta tgagattatt      1140
     acagacttaa ataaaggcga ttatatgagt ttaaccggta atataatctc tattattaat      1200
     gatccttcat ttaaattaaa agatatctta gtagagcaaa gtaaaaaagg gttatttgat      1260
     aacttaatta atggtgtttt agcacaagat gaaaaaaata gccaaattat aaaacaacaa      1320
     cttataaatt atggtatgga agcaagtgat gttacaaagc tcactagaat aatgcctata      1380
     ttacttgata aaccggaatc cttaaaaaat gtttttcgcg attttattaa aggtaattat      1440
     acgcaaatga caaaagagtt aatagtttta actaaagata atcctgaaat taaagaatat      1500
     ttaaataata atagaacaat atttgcaaat attttagata aaactttatc agatatacca      1560
     ggtataaata accttgataa gcaagaatta tataatgtac taccatcaat gttaaattat      1620
     cctggtgagt tagttaaaat tatagaagaa gttgaaaaaa gtaattacca tggtgcaatt      1680
     agtgcgatat atgatctagc tcaaaaaaca aattattttg aaggacaatt acctaatatt      1740
     ataaaagcag ggtttaactc agggtttaac tatgctactg aaaaagtaaa agatatattt      1800
     agttcatcac aagattttaa agataaagct atagatgaaa ttactattag aacaaattta      1860
     gataaaatac gaaatagaaa attcaactta gaaggcgcta tattatcagg taatttatca      1920
     aatattgatt tctcaggtgt atcacttaaa aatgcagatt taactcaagt aacttcgtta      1980
     agagattgta attttaaaaa tactaattta gtagatgcta aattaccaga taatttaata      2040
     atatttacag acacttataa tcttgataag actatcccta ctttagcacc taaactaatt      2100
     aaagcacaac aagcaaaatt agttgataag gcaattgata aagtatttgt acaaataaaa      2160
     gctgaagaca aaagaaattt agttagtaaa aaagaatttg tacaacaagt aaaaatatta      2220
     cttgaagaaa atcaaatagt taaagactat attatagata agttaaattc attgcctatg      2280
     aatatggtta ctaatctaga aactcctaaa ataaatcaat ataaacatat tacaaatcat      2340
     gttaattcgc catttcaaat attgaatccg ttatatgaaa atattgcaaa tcaacaagat      2400
     attaagagta atttatttgc aaatatttta agcgagaaaa tatcaaaaaa actttttgat      2460
     aaaggtgata atagaggtga agatttttat ctgattaatc agatgctaaa atctatcgtt      2520
     gctgaatatt ctaaaccaaa ccaaaataat attgataatt ttttagagca tcaaaatcta      2580
     gaaaagttag caagtaatat tgcatctact ttctattcta aatctaaata taccttatta      2640
     ggcactatta ccagtggaat ttatttacca aaagaaatct ttaatgaaca gttaaaagat      2700
     aatttaaaga atgagtttaa aaaaattaat acatcagatg tattaaaaga agcaaaaagt      2760
     atagtttcaa atttagatag taaagtacat atagtagata ataagaataa atcgcatact      2820
     tacaaatcag tacttacaaa aaatcaaaaa atacatagat aa                         2862
//

If you have problems or comments...

PBIL Back to PBIL home page