(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE481

AE017197.PE481       Location/Qualifiers
FT   CDS_pept        640260..640412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03971"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WM1"
FT                   /protein_id="AAU03971.1"
FT                   /translation="MQKSVIANVHILISLLFTDQLYRYHQYLNLLHTIMHTKLFASYTS
FT                   LYKNT"
     atgcaaaagt ctgttattgc aaatgtgcat atacttatat cgcttctttt tactgatcaa        60
     ttgtatagat atcatcagta tttaaacctt ttacacacta ttatgcacac taaattattc       120
     gcatcatata ctagcttata taaaaatact taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page