(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE486

AE017197.PE486       Location/Qualifiers
FT   CDS_pept        complement(645384..645518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03976"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WL6"
FT                   /protein_id="AAU03976.1"
FT                   /translation="MENTFAVYINYKCDNTSSNVLYFDQMHQVLIDMWYKILKMDAAC"
     atggaaaaca cttttgcagt ttatataaat tataagtgcg ataatacatc tagtaatgta        60
     ttatactttg atcaaatgca tcaagtcttg attgatatgt ggtacaaaat attgaaaatg       120
     gatgcagcat gttaa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page