(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE493

AE017197.PE493       Location/Qualifiers
FT   CDS_pept        complement(654254..655576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03983"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WK9"
FT                   /protein_id="AAU03983.1"
FT                   /translation="MNNLKKIKNITISKDLAEVQEHYQDYPYPFRDPNHEKERLLAICG
FT                   EFLGELNHFLYKGKENFNNNFRCLIAGGGTGDSTIYLAEQLKDKNAEIIYLDFSKPSME
FT                   IAQKRAEVRGLKNIKWINNSILNIPNLKLGKFDYINCTGVLHHLANPDEGLKNLKASLK
FT                   PTGGMGLMVYAKYGRTGVYQIQDLMKMINKDTKNRIEEIMNGKLILDNLPATNWYKRGC
FT                   DLFSDYQNFGDIGVYDMFLHKQDRAYSIPELYEFIAKADLNFVDYLDPLEKILLRTENY
FT                   IKDFTLLQKVKKMDKVTQEAISEILTGNIIKHSFYVSNQKDSVASLDNLDNIPYFHNIF
FT                   NFAKQIYEYLESNSSSINNVINFTINNGILNNVNISMSIFRSTKYIFKYMIEEKSLREI
FT                   FDAVRSELNQEISDEALLNEVKNVFMPLLNTNVLLLKSKDL"
     atgaataatt taaagaaaat aaaaaatatt acaatttcta aagatttagc agaagtacaa        60
     gaacattatc aagattatcc ttatcctttt agagatccaa atcatgaaaa agaacgttta       120
     cttgcaattt gtggtgagtt cttaggagaa ttaaatcatt ttttatataa aggaaaagaa       180
     aattttaata ataattttag atgcttaata gcaggtggtg gtaccggtga ttcgactatt       240
     tatcttgctg aacagttaaa agataaaaat gctgaaataa tatatctaga ttttagtaag       300
     cccagcatgg aaatagcaca aaaacgtgca gaagtacgag gtcttaaaaa tattaaatgg       360
     attaataatt caatattaaa tatacctaat ctaaaacttg gaaaattcga ttatataaat       420
     tgcactggcg tgctgcatca tttagcaaat cccgatgaag gtctaaaaaa tcttaaagct       480
     tctttaaaac caacaggtgg tatgggctta atggtatatg ctaaatatgg acgtactggt       540
     gtttatcaaa ttcaagattt aatgaaaatg ataaataaag atactaaaaa tcgtattgaa       600
     gaaataatga atgggaagtt aattctagat aacttgcctg ctactaattg gtacaaaaga       660
     ggttgtgatt tattttcaga ttaccaaaat tttggtgaca ttggagttta tgatatgttc       720
     ttgcacaaac aggatagagc ctattccatt cctgagttat atgaatttat agcaaaagca       780
     gacttaaatt ttgttgatta tcttgatcct ttagaaaaaa ttttattaag aacagaaaat       840
     tatataaaag attttacact cttgcaaaaa gtgaaaaaga tggataaagt aactcaagaa       900
     gcaatttctg aaatacttac aggtaatatt attaaacatt cattttatgt atcaaatcaa       960
     aaagatagtg tagcatctct tgataacctt gataatatac catacttcca taatatattc      1020
     aattttgcca aacaaattta tgaatatttg gagtctaatt cttcatcaat aaataatgtt      1080
     attaatttta ctattaataa tgggatatta aataatgtta atatctcaat gtcaatattt      1140
     agaagtacta aatatatttt taaatatatg atagaagaga aaagtttaag agaaatattt      1200
     gatgcggtac gcagtgaatt aaaccaagaa ataagtgatg aagcattatt aaatgaagtt      1260
     aaaaatgtat ttatgccatt acttaataca aatgttttat tgttaaaatc aaaggatttg      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page