(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE5

AE017197.PE5         Location/Qualifiers
FT   CDS_pept        2840..5896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03495"
FT                   /db_xref="GOA:Q68XZ7"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q68XZ7"
FT                   /protein_id="AAU03495.1"
FT                   /translation="MKLGFNLDFNELDLTGLKKLDQIFLDYLFKADKSLHKDLMLFRAT
FT                   PFSIIPQDYSKFLLKISPHLDDFLAELFCISKEVTISRLKHKDFDIIYECKRKFIQRVA
FT                   VKKYPLEKIKDIDFEDVYLKITNLIGTNFTSREFAKQIVIWQQDEESFSLELDIAARYA
FT                   AYRVFSCYNSLSSWNKNLFLQNDILFNFQQKLDKTNLIDDKKILKYQKNERLDFDYKDS
FT                   FLNLDEALNNSHYCIYCHKQDKDSCSKGFGVIPHFDRVISVDSLEYKIPWLRYSMTTGC
FT                   PLKQKISEMNYIKAQGFNLAALAIIVIDNPMVAATGNRICNDCSKACIYQKKQDPVNIP
FT                   LIESNILEETLKLPYGLEIYILLTRWNPLNIYAPLPKEPTNYNILVTGLGPAGFSLSYY
FT                   LLRSGHNVTAIDGLKITPLSFNIHKPIKFWHEYKNLLSERIPKGFGGVSEYGITIRWDK
FT                   NNLDILRLILERNNNFKYYDGVALGFNITKEQALDLNFDHVAFCIGAGKPKVLNIENFE
FT                   AKGVKTASDFLMTLQSGGAFLKNSNTNMVIRMPIVIIGGGLTSLDAATESLFYYKKQVE
FT                   EFAKNYIKQDLTEEDQEIAEEFIAHAKLFKEAKNNEELKKVFNKLGGATVYYRGRLQDS
FT                   PAYKLNYEELIYTLALGVDFKENMQPLRINIDKYGHVESVEFSVTTWFDSRTHNIYHSN
FT                   MRPTVKPSGNTALIKTKTVIMAIGIENNTQFDDDKYSYFGDCNPKYFGSVVKAITSAKE
FT                   GYEAINTRLINNVPSFKGSYAYFITQLDYLLTSRINKINILNDKTFEIIIHSPLAAKNF
FT                   KFGQFFRLQNYSKDITKLIEPIALSPVDIDIEKGLISFIVYAVGKSTRLCKTLSENEKV
FT                   VLMGPTGSPLKIPKNKKIIIIDSKYRNVGLLKILKENKNKVIFATYPDIKNHKLTSVDI
FT                   VIINTSPEIAEELQKLKIFGKNTELIVNVNSSMQCMMKGICGQCVQKVKGKQKYIFACS
FT                   GQNQNAEIIDFKSLKARLRQNSLQEKMSN"
     atgaaacttg gttttaatct agattttaat gaattagatt taaccggact taaaaaatta        60
     gatcaaatat ttttagatta tctatttaaa gccgataaat ctttgcataa agatttaatg       120
     ttatttagag ctactccttt ctcgattatt ccacaagatt attccaaatt tttgctaaaa       180
     atttctcctc atttagacga ttttttagca gagttatttt gtatttcaaa agaagtaaca       240
     atatcaagac tgaagcataa agattttgat atcatttatg agtgtaaacg aaaatttatt       300
     cagcgtgttg cagtaaaaaa atatccctta gagaaaataa aagatattga tttcgaagat       360
     gtatatttaa agataactaa tttaataggc acgaatttta cttctagaga atttgcaaag       420
     caaattgtta tatggcaaca ggatgaagaa agcttctctc tagaattaga catagcagct       480
     aggtacgctg cgtatagggt ttttagttgt tataactcat tgtcatcatg gaataaaaat       540
     ctgtttttac aaaatgatat actatttaat tttcaacaaa aattagataa aacaaatcta       600
     atagatgata aaaaaatatt aaaatatcaa aaaaatgaga gattagattt tgactataaa       660
     gattcttttt taaatctaga tgaagctcta aacaattctc attattgtat ttattgtcat       720
     aaacaggata aggatagctg ttctaaggga tttggtgtaa ttccacactt tgatcgcgtg       780
     atctcggtag atagtttaga atataagatt ccgtggttaa gatatagtat gacaactggt       840
     tgtccattaa aacaaaaaat ttctgaaatg aattacatta aagcacaagg ttttaaccta       900
     gcagctcttg ctattattgt tattgataat ccgatggttg cagcaacagg taataggatt       960
     tgtaatgatt gctctaaagc ttgtatttac caaaaaaagc aagatccagt aaatattccg      1020
     ttaatagaat caaatatttt agaagaaacg cttaaattac cttacggttt ggagatatat      1080
     atacttctta cacgttggaa cccgcttaat atttatgcac cgcttccgaa agaacctaca      1140
     aattataata ttttagttac aggtcttggt cccgcaggtt ttagccttag ctattattta      1200
     ttgcgatcag gtcacaatgt cacagctatt gacggtttaa aaataacccc tttatctttt      1260
     aatattcata aacctataaa attttggcat gaatataaaa atttgttatc agaaagaata      1320
     ccaaaaggat ttggaggggt atcagaatat ggtataacta ttcgttggga taaaaacaat      1380
     cttgatatat tgcggctaat acttgagaga aataataatt tcaaatatta tgatggagta      1440
     gcgttaggtt ttaatatcac gaaagaacaa gctttagatt tgaattttga ccatgtagct      1500
     ttttgtattg gagcaggtaa gccaaaggtt ttgaatatag agaattttga agctaaggga      1560
     gtaaaaacag cttctgattt cttgatgact ttgcaaagtg ggggagcatt tttgaaaaat      1620
     tctaatacta atatggtgat taggatgcca attgtgataa taggtggtgg tcttacttct      1680
     ttagatgcag caacagaaag tttattttac tataaaaagc aagtagaaga atttgctaaa      1740
     aattatataa aacaagattt aacagaagaa gatcaagaga tagctgaaga atttattgct      1800
     catgcaaagt tgtttaaaga agctaaaaat aatgaagaat taaaaaaggt ttttaataag      1860
     cttggagggg ctaccgttta ttatcgtgga agattgcaag attcgccagc ttataaatta      1920
     aattatgaag agctgatata tacgttagca cttggtgttg attttaaaga aaatatgcag      1980
     cctttaagaa ttaatattga taaatatggt catgtggaat ctgtagaatt cagtgttacc      2040
     acttggtttg acagtaggac gcataacata taccatagta atatgcgtcc tactgtcaaa      2100
     ccaagtggta acactgcctt aatcaaaact aaaaccgtaa ttatggcaat tggtatagaa      2160
     aataatactc aattcgatga tgataaatat agttatttcg gtgattgtaa tcctaaatat      2220
     tttggtagtg tagtgaaagc cattactagt gcaaaagaag gttatgaggc tattaacaca      2280
     agacttataa ataatgttcc tagctttaaa ggtagttacg catattttat aacacagctt      2340
     gattatttgc taacttctag gattaataaa ataaatattt tgaatgataa aacttttgag      2400
     attataattc actcaccact tgctgctaaa aattttaaat ttggacagtt ttttcgtttg      2460
     caaaattatt ctaaagatat tactaagtta atagagccta tagctttaag tcctgtcgat      2520
     atcgatatag aaaaagggtt aattagcttt atagtttatg cagttggtaa gtctactaga      2580
     ttatgtaaaa cattatcaga aaatgagaaa gtagttttaa tggggccgac aggttcacca      2640
     ctaaaaatac ctaagaataa aaaaataatt attattgatt ccaaatatcg taatgtaggc      2700
     ttattaaaaa ttttaaaaga aaataaaaat aaagttatat ttgctaccta tcctgatata      2760
     aaaaaccata aattaacttc tgtggatata gtaataatta atacttctcc tgaaatagct      2820
     gaggaattac aaaagttaaa aatattcggt aaaaatacag aattaatagt taacgttaat      2880
     tcatcaatgc aatgtatgat gaaaggaatt tgtggacaat gtgttcaaaa agttaaagga      2940
     aagcaaaaat atatttttgc atgtagcggg cagaatcaaa atgcagaaat aattgatttt      3000
     aagagcttaa aagctcgatt acgccaaaat tctttacaag agaaaatgag taactaa         3057
//

If you have problems or comments...

PBIL Back to PBIL home page