(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE515

AE017197.PE515       Location/Qualifiers
FT   CDS_pept        684741..685451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0536"
FT                   /product="possible RecO-like recombinational DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04005"
FT                   /db_xref="GOA:Q68WI7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI7"
FT                   /protein_id="AAU04005.1"
FT                   /translation="MNIKDIGVIISKKPLKENTFIIRVFTKNHGLYSGVIKASSKKNKF
FT                   IYQEGNIVDFLWQARLHEHIGIAKCELIKSYTGYFIINKAKLYAFNSVKFLIQELFHER
FT                   EEHSIFFAFLINYLDNLSKNFCFRDYINFELNLLAETGYKIDLTKCCVSHVTTDLTYVS
FT                   PKSARALSYKVGKPYRDKLLILPKFLLSEDSKITLEEKKQALTLTNYFFNRYLFHNNRQ
FT                   VEARKEFIEYITNI"
     atgaatatca aagatatagg ggtgataatt tcaaaaaaac ctttaaaaga aaatacattt        60
     attattagag tttttactaa aaatcatggt ttatattctg gagttataaa agcatcttca       120
     aaaaaaaaca aatttatata tcaagaaggc aatattgtag attttctttg gcaagcaaga       180
     ttacacgaac atatcggcat tgctaaatgt gaactcatta aatcttacac aggttatttt       240
     ataataaata aagctaaatt atatgcattt aattctgtta aatttttaat ccaagaatta       300
     ttccatgaaa gagaagaaca ttctattttt tttgcatttc taattaacta tttagataat       360
     ttatccaaga atttttgttt tcgtgactat attaattttg aactaaattt acttgctgag       420
     actggttata agattgatct tactaagtgt tgtgttagcc atgttacaac tgatttaacc       480
     tatgtatcac ctaaatcagc tcgagcatta tcatataaag tagggaaacc ttatagagat       540
     aaactattga tcttaccaaa atttttactt tcagaagata gtaaaattac attagaagaa       600
     aaaaaacaag ctttaactct aacaaactat ttttttaata gatatttatt tcataataat       660
     agacaagtcg aagcacgcaa agagtttata gagtatataa ctaatatttg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page