(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE517

AE017197.PE517       Location/Qualifiers
FT   CDS_pept        complement(686867..687124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04007"
FT                   /db_xref="GOA:Q68WI5"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WI5"
FT                   /protein_id="AAU04007.1"
FT                   /translation="MIRGKNHMTYLHVIPVLVLAIVIEISGNKVENFNSALATNILGND
FT                   FRFFDDVMYYCTQKFISTFSNFIVIFLDVIYLYHWRVSQA"
     atgataagag gtaagaatca tatgacgtat cttcatgtga ttccggtttt agttttggca        60
     attgtaatag aaatatcagg aaataaagta gaaaacttta atagtgcttt ggccacaaat       120
     atattaggta atgattttag attttttgat gatgtgatgt attattgtac acaaaaattt       180
     atttctactt ttagtaattt tattgtaatc tttttagatg ttatttattt atatcattgg       240
     cgtgtgtcac aagcgtaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page