(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE52

AE017197.PE52        Location/Qualifiers
FT   CDS_pept        complement(74987..75871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU03542"
FT                   /db_xref="GOA:Q68XV0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68XV0"
FT                   /protein_id="AAU03542.1"
FT                   /translation="MNDALKTYLKGICWFLLSLVTSSVNDVISKYLGTRLHSFEVAFFR
FT                   FLFSSIVLLPFVVYYGKSTLKTRHPVIHVLRGLLLFFGMTSWTYGLTIAPVTTATVISF
FT                   SIPLFTLILAVFILNENIIWQRWVVTVVGFIGLVVMLKPHTKDFNPEILYLILAAISFA
FT                   MLDIINKKFVVKESMLSMLFYSAIVTAIVSLPVSMEYWITPSSFELTLLFVLGSSGSFI
FT                   LFFLLKAFTMVDATATAPYRYLELVISAIAAYFIFNEFPDKSTAHGAVIIIPATLFIMY
FT                   SEKKSMSSKHESQ"
     atgaatgatg cattaaaaac atatttaaaa ggcatatgtt ggtttttact tagtttagta        60
     actagtagtg taaatgatgt gatatctaaa tatcttggga ctcgtttaca tagctttgaa       120
     gtagcttttt tccggttctt gttcagtagc atagttttac taccttttgt tgtttattac       180
     ggtaaaagta ctttaaaaac aaggcatcct gttattcatg tattaagagg attattatta       240
     ttctttggta tgacttcatg gacttacggt cttaccatag caccagttac tactgcaacc       300
     gtcataagtt tttctattcc tttatttact ttaatacttg ccgtattcat tctcaatgaa       360
     aatattattt ggcaaagatg ggtagtgact gtagtaggat ttatagggct tgttgttatg       420
     cttaaaccac ataccaagga ttttaaccct gaaattttat atttgatatt agctgctatt       480
     tcatttgcta tgcttgatat tattaataaa aaatttgttg taaaagaatc aatgttgagt       540
     atgctatttt attcggcaat agtaactgct atagtgtcgc taccagtgtc gatggagtat       600
     tggataaccc ctagtagttt tgaattaact ttattatttg tacttggcag tagtggaagc       660
     tttatattat tcttcctgct taaagctttt actatggtag atgcaactgc tacagctcct       720
     tatcgatatt tagagttagt gatttcagca atagcagcat atttcatatt taacgagttt       780
     ccagataaaa gcactgctca tggagcagtg ataatcattc ctgcaacctt atttataatg       840
     tactccgaaa aaaaatctat gagcagtaaa catgaatcgc agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page