(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE520

AE017197.PE520       Location/Qualifiers
FT   CDS_pept        complement(692815..693300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04010"
FT                   /db_xref="GOA:Q68WI2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q68WI2"
FT                   /protein_id="AAU04010.1"
FT                   /translation="MQTIEQQITNIIEESLTDMGFELVLVKFKGVNTKVVEILIDSLNG
FT                   NKISIEDCTNVSRTISAILDVEDLIEDAYSLEVSSSGIERKLVKFENYNRFLGREVKVK
FT                   LKALLNGKTLYQGKIIKAENNKIYLKCAEQEVLIDFNLIKNANLVLTEEVFKKLLGS"
     atgcaaacta ttgaacaaca aataacaaat ataatagaag aatccttaac tgatatggga        60
     tttgagttag ttcttgtgaa gtttaaaggt gttaatacta aagtagttga gatattgatt       120
     gatagcttaa acggtaacaa aatatctata gaagattgta ctaacgtaag taggactatt       180
     tctgctattc tagatgttga agatttaata gaggatgcat attctttaga agtatcatca       240
     agtggtattg aacgtaagtt ggtgaaattt gaaaattata ataggttttt aggaagagaa       300
     gttaaagtca aactcaaagc attattgaat ggaaaaacac tttatcaagg taaaataatt       360
     aaagctgaga ataataaaat atatttaaaa tgtgcagaac aagaagtatt aattgatttt       420
     aatttaatta aaaatgccaa tctggtttta actgaagaag tatttaaaaa attattaggt       480
     tcttga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page