(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE524

AE017197.PE524       Location/Qualifiers
FT   CDS_pept        699459..705140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04014"
FT                   /db_xref="GOA:Q68WH8"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH8"
FT                   /protein_id="AAU04014.1"
FT                   /translation="MKNICCKCVLTIFLYLINLQVIATSFNEKIPVYLKLTNEKMLAGK
FT                   NSLNIDLCDSRIKEWCAKPQREMGLNRQKINEYISISPDIKGEWRFGWNYNINFIPEEN
FT                   FLPNQTYKITIKDSIFPNFISLKKNNISFTSLPLLSMIKEMNYLQDNINISQKFVQTKI
FT                   AFNYPIDPKSLEERIEFIKSSTKEKLSFSIKFNTDKTEAISITNIPPLTDKKDIVSIII
FT                   KDGVKILYGDEIFTQKNVDIQNNKMMQNNIRYSYKENVLIPSLSSYLKITNSTATIVKD
FT                   DKLKPEQIIIITTNTPVSGEEVKKHLELFLLPKNKPHFLGVAGKKNYKWQSPREITDDI
FT                   LKLSEKINFELLPAVPKITNVHHFKVDTLASRTVLIKIKKGVRTLDNLTLGSDYTQIIQ
FT                   IPDNPKEVKFMSDGSILSLSGKKKLPVYSLGIDKLYVEIDKIHQQEINHLISQTNRYNI
FT                   FQNPTFINEYSFNEYNISDVFQEEVIVNSQNLNLPHYTDLDFSKYLHLEQAGRYSKGLF
FT                   LAKVYSKDNNNNIISQDKRLILVTDLGFIVKTDKTGTHHIFVSYISNGKPAEGVKADII
FT                   GLNGEILVSSKTDSQGHTVLSNIRDLNKGKIPIAYVLTTKDDFSFMPYNRVDQQVNYSR
FT                   FDISGTVNSEEGLKAYLFSDRGIYRPSEQGHIGIMLKQNDWHGKFDGLPLGIQVTNPYG
FT                   RVIDKNKIVLNSEGLGEYLFTTFDDSLTGLYNISLYLGEPGINNYLNSVSVRVGDFQPD
FT                   RMKININFNNSKDTLWTHPKDLKATVKLINLYGIPAENRKVRGLIDIRPTEFFVANFKE
FT                   YTFYRSKDNKEFFNEHLGDVTTDSTGTANFDLNLDKYYNATFNLTFSAEGFEPDSGRSV
FT                   QGSKSLIVSPLPYIIGFRSNSNLKYIKKQVISTIEFIAISNKAKKVSAHNLTLKLNKIN
FT                   YVNNLVSDSNGNYSYSAVPVETNISSDNVNITENEGYIYNVPTNEEGDYVIYLTDTENR
FT                   IFAQTEFSVIGEGNVTANLINKANLKVKLDKGDYKAGDTILLNINTPYTGYGLITIETD
FT                   KVHNFKWFKADKNNSIQEIKIPDGFEGKGYVNVQFIRDITDTEIFISPFSYAVLPFTAG
FT                   VYKHKENIELTLLPKIKSGEKLSIRYRTTNPCKIIIFAVDEGILSFADYQTPDPINYFM
FT                   NDKALEVRTSQIMDLILPEHHLLMKSYIASPPGDSFINVSRNLNPFKRNSQPPVTFWSG
FT                   ILESDLNEREITFDIPSYFNGTLRVIGIASSLDTIGVSKTDLLVQSDLIINTNLPLFVA
FT                   PNDEFAVPITIFNNLKDSGNAQIFLNIETSEGLEILDYPKAIQIDENNEATINVKLKAT
FT                   DKLGSANLNVVASINNIKTDITSMTLVHSSELTSTTSVRPASPNITTVDTGFIPGNKAN
FT                   LKILRDLYPKFAKLQISASKSPLAIISGFKDFLDNYHYGCTEQLVSQNFANVLLYNEQE
FT                   LVQILKTDRKKMDESLSKIFQTLLERQNDDGGFRYWNNFYDDSDPFISVYTMHFLNEGV
FT                   TRYLAVPSDMFNAGLYYLENIANREINSLDEAREKAYAIYILTRNSIITTNYIANILKY
FT                   LDEYHKNTWHDDLISVYLASSYKMLKMDEDADKLLDRFTLNKPISKTNYQYYNQLIKYS
FT                   QYLYLISLHFPERLKNFDSKIIQDIALFAKDNYNSLSASYAIMASLTYAAKIHNVDEAT
FT                   IKVTDTDKVVTLKGDKVMISELSLESNEIDLTSSSNGFFYQLLTSGYDKQLKGNKEIVQ
FT                   GIEITKKYLDENNKEVSKVKLGDNITVNITINSASNKTLSNIVILDLLPGGFELLQDNN
FT                   NLNILERHQEIMIWKPIYINNRDDRVMIFGTISDQKMTYRYKIKAVNKGIFTTTAVYGQ
FT                   AMYDTQTYYRGSIGCIIVE"
     atgaaaaata tttgctgtaa atgtgtattg actattttct tatatttaat aaatttacaa        60
     gtaatcgcta caagctttaa tgaaaaaata cctgtatatt taaaattaac gaacgaaaag       120
     atgttagcag ggaaaaattc gttaaatatt gatctttgcg attctagaat taaagaatgg       180
     tgtgcaaagc ctcaaagaga gatgggactg aacaggcaaa aaataaatga gtacatatct       240
     atttcacctg atattaaagg ggagtggaga ttcggatgga attataatat aaattttata       300
     cccgaagaaa attttttacc taatcaaacg tataaaatta ctatcaaaga tagtatattc       360
     cctaatttta tcagtttaaa aaaaaataat ataagcttca cgtctttacc actactttct       420
     atgattaaag aaatgaatta tctacaagat aatatcaata tttctcaaaa atttgtccaa       480
     acaaaaatag cttttaacta cccaattgat cctaaaagtc tagaagaaag aatagagttc       540
     atcaaatctt caactaaaga gaaattatca ttttcgatca aattcaatac agataagaca       600
     gaagctatat cgattaccaa tataccaccg cttacagata aaaaagacat agtatctatt       660
     attataaaag acggggttaa aatattatat ggggacgaaa tttttacgca aaaaaatgta       720
     gacattcaaa ataataagat gatgcaaaat aatataagat attcttataa agaaaatgta       780
     ttaattccaa gtctatcctc atatttaaaa atcactaata gtactgctac aattgttaaa       840
     gatgataaac tgaaaccgga acagataatt ataattacta caaatacacc agtttcaggt       900
     gaagaggtaa aaaaacattt agagttattt ttattaccca aaaataaacc tcatttttta       960
     ggagttgcag gtaaaaaaaa ctataaatgg caaagcccaa gagaaataac ggatgatatt      1020
     cttaaattaa gtgaaaaaat aaattttgag ctactacctg ccgtcccaaa aattactaat      1080
     gtacatcact tcaaagtaga tacgcttgcc tcaagaactg tgcttattaa aataaaaaaa      1140
     ggtgttagga cattagataa tttaactctt ggctcagatt acactcaaat aatacaaata      1200
     cctgataatc ctaaagaagt aaagttcatg tcagacggat ctattctctc attatctggt      1260
     aaaaagaaac tcccagtata ttcacttggt atagataaat tatatgtaga aattgataaa      1320
     attcatcagc aagaaattaa tcatttaata agccagacaa atagatacaa tattttccaa      1380
     aacccaactt tcataaacga atattctttt aatgagtata atatttcaga tgttttccaa      1440
     gaagaggtaa tagttaattc tcaaaatctc aatttacctc attatacaga tttagatttc      1500
     agtaagtatt tacatttaga gcaagcagga agatattcta agggactatt tttagcaaaa      1560
     gtctactcta aagataataa taataatatt atatctcaag ataaaagatt aattttagtt      1620
     actgatcttg ggtttatagt aaaaactgat aaaacaggaa cacatcatat atttgtttct      1680
     tatatcagta atggtaaacc tgcagaaggt gtaaaagcag atattatagg acttaatggt      1740
     gagatattag tcagcagtaa aactgatagc caaggacata ctgttttatc aaacatacgt      1800
     gatttaaata aaggaaaaat cccaatagct tacgtgttaa ctactaaaga tgatttctcg      1860
     tttatgccat ataatagagt ggatcaacaa gttaattatt ctcggtttga tatatcaggg      1920
     actgttaatt ctgaagaagg actaaaagct tatttatttt ccgatcgcgg catttataga      1980
     ccaagcgagc aaggccacat aggtattatg ctcaaacaaa atgattggca cggcaaattt      2040
     gatggtttac ctttaggaat acaagtcact aacccttatg ggagagtaat agataaaaat      2100
     aaaatcgttc taaattcaga agggcttggt gaatatttat tcacaacatt tgatgattct      2160
     ttaacaggct tatataatat aagcttatat ttaggtgagc caggaataaa taattatctt      2220
     aatagcgtat ctgtcagagt tggagatttt cagcctgacc gcatgaaaat aaatataaac      2280
     ttcaataact caaaagatac gctatggact catccaaaag accttaaagc aacagttaaa      2340
     cttataaatc tttacggcat tcctgcagaa aatagaaaag tcagaggttt aattgatatt      2400
     agacctacag agttttttgt tgccaacttt aaagagtata cattctatcg tagtaaagac      2460
     aataaagagt tttttaatga gcatttagga gatgttacta cggattctac aggtacagca      2520
     aattttgacc ttaaccttga caaatattat aatgctactt ttaatctaac attttctgca      2580
     gaaggctttg aacctgactc aggaagaagc gtacagggca gtaaatctct tatagtgtca      2640
     cctcttcctt atattatagg ttttagaagt aacagcaacc ttaagtatat taagaaacaa      2700
     gtgatttcaa caatagaatt catagccata tccaataaag caaaaaaagt atctgcacat      2760
     aatttaactc ttaagttaaa caagattaat tacgtaaata atttagtatc agatagtaat      2820
     ggtaattatt cttacagtgc agtacctgtt gaaacgaata tatcttctga taatgttaat      2880
     atcacagaaa acgagggtta tatttataac gtacctacta acgaagaagg tgattacgtt      2940
     atttacctaa cagatacaga aaatagaatc tttgctcaaa ctgaattttc agtaataggt      3000
     gaagggaatg tcacagctaa tttaataaat aaagcaaatt taaaagttaa acttgataaa      3060
     ggtgattata aagcaggcga tactattctt ttaaatatta acactcctta tacaggttat      3120
     ggattaatta ctattgagac tgataaagta cataatttta aatggtttaa agctgataaa      3180
     aataatagta ttcaagaaat aaaaatacct gacggttttg aaggtaaagg atacgtaaat      3240
     gtacaattta taagagacat cacagatacg gaaatcttta tttcaccatt tagctatgca      3300
     gtactaccgt ttactgcagg agtgtataaa cataaagaaa atattgaatt aacattgctc      3360
     ccaaaaatta aatcaggtga aaagttatca attcgttacc gtactactaa tccttgtaaa      3420
     atcataatat ttgctgttga tgaaggcata ctatcatttg ctgattatca gactccagac      3480
     ccgattaatt acttcatgaa cgataaagca ttagaagtac gaacttcaca aatcatggat      3540
     ttaatattgc ctgagcatca tttattaatg aaatcttata tagcatctcc tccaggcgac      3600
     agttttataa atgtatctcg caaccttaat ccgtttaaaa ggaatagcca acctcctgta      3660
     acattttggt caggcatttt agaatcagat cttaatgaga gagaaataac attcgatata      3720
     ccaagctatt ttaacggcac tttaagagtg ataggtatag catcaagcct tgatactata      3780
     ggagtttcta aaactgattt attagtgcaa tctgatctta ttatcaatac aaatttacct      3840
     ttatttgtag ctccaaatga tgaatttgca gtaccaataa caatatttaa taacctaaaa      3900
     gattcaggaa atgctcaaat ttttttaaat attgaaacaa gcgaaggact tgaaatatta      3960
     gattatccta aagcaataca gatagatgaa aataatgaag ctactattaa tgttaaatta      4020
     aaagcaactg ataaactcgg ttcagcaaat ttaaatgttg tagcgtctat aaataacata      4080
     aagactgata taacgtctat gacattagta catagctcag aattaactag cactacgagt      4140
     gttcgtcctg ctagcccaaa tatcacaacg gttgatacag gctttattcc aggcaataaa      4200
     gctaatttaa aaatcttgcg tgatttatat cctaaatttg ctaagttgca aatttctgct      4260
     tctaaatctc ctcttgctat tatttcaggc tttaaagatt ttttagataa ttatcattat      4320
     ggctgcaccg aacaattagt cagccaaaat tttgccaatg ttttattata taatgagcaa      4380
     gagctagttc agattcttaa aactgatcgt aaaaaaatgg atgaatcatt atcgaaaata      4440
     tttcaaacat tattggaacg tcaaaatgat gacggtggat ttagatattg gaacaatttt      4500
     tacgatgatt ctgatccatt tatttctgta tatactatgc acttcttaaa cgagggagtc      4560
     actagatatt tagctgtgcc aagtgatatg tttaacgcag gtctttacta cttagagaat      4620
     attgcaaata gagaaataaa ttctttagac gaagcgagag aaaaagcata tgcaatttat      4680
     atcttgacga gaaatagtat tattactaca aactatattg caaatatttt aaaatattta      4740
     gatgaatacc ataaaaatac atggcatgat gatttgatta gcgtttattt agcatctagc      4800
     tataaaatgc taaaaatgga tgaggacgca gataaattac tagatagatt tactctcaat      4860
     aaacctatat caaaaacaaa ttaccaatat tataatcaat taataaaata tagtcagtat      4920
     ttatacttaa tttctttaca tttccctgag cgattaaaaa actttgactc aaaaattatc      4980
     caagatatcg ctctttttgc aaaagataac tacaatagtc tatcagcaag ctatgcaatt      5040
     atggcaagtc ttacctatgc tgctaaaatc cataatgtag atgaggctac tattaaagta      5100
     actgatacag ataaagtagt aacgttaaaa ggtgataaag tgatgatttc tgagttgtca      5160
     ttagagagta atgagataga cttaacatca tcaagtaacg gctttttcta tcagctatta      5220
     acttcaggct atgataagca attaaaaggc aataaagaga tagtgcaagg aatagaaata      5280
     actaaaaaat atctcgatga aaataataaa gaggttagta aagtaaaatt aggtgataat      5340
     attactgtga acatcactat aaattcagct agcaataaaa ccctgagcaa tattgtgata      5400
     cttgatttat taccaggagg ctttgagctt ttacaagata ataataattt aaatatacta      5460
     gaacgtcatc aggaaataat gatatggaaa ccgatatata taaataatcg tgatgataga      5520
     gtaatgattt tcggtactat ttctgatcaa aaaatgactt atcgatataa aataaaagca      5580
     gttaataagg gaatatttac aaccactgct gtttacggtc aagctatgta cgacacgcag      5640
     acttactatc gtggtagtat aggatgtatt attgttgagt ag                         5682
//

If you have problems or comments...

PBIL Back to PBIL home page