(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE532

AE017197.PE532       Location/Qualifiers
FT   CDS_pept        complement(717640..718161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0554"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04022"
FT                   /db_xref="GOA:Q68WH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WH0"
FT                   /protein_id="AAU04022.1"
FT                   /translation="MLKIKQEIYKNSLQVILQFFFALLCFCIILFPLMSYKINIQSRIF
FT                   PAMEIIFIYYFMSLYSLNILSIFFLGLLIDQISGVPIGTDSLVFISANIIYKLSSKYFL
FT                   AKNYLINFVVFCVYCLFILNFKYLLVTIKHLDAEGYLIIFFQFLTTIFSYNIIRLILDS
FT                   PMNYFKKYAK"
     atgttaaaga tcaaacagga aatatataaa aatagcttgc aagtaatatt acagtttttc        60
     tttgctttgc tatgtttttg tataatacta tttccactaa tgagttataa aataaatatc       120
     caaagtagaa ttttcccagc aatggaaatt atatttattt attattttat gtcgttatat       180
     tccctaaata ttcttagcat atttttttta gggctattga tagatcaaat aagtggcgtg       240
     cctattggta cagattcttt agtttttata tcagcaaata taatttataa attatcttca       300
     aaatattttt tagctaaaaa ttatttaata aattttgttg ttttttgtgt ttattgttta       360
     tttatattga attttaaata tttattggta acaataaagc atctagacgc agaggggtat       420
     ctaataattt tttttcaatt tttaacaact atattttctt ataatataat tcgtcttata       480
     cttgactctc ctatgaatta ttttaaaaaa tatgctaaat aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page