(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE534

AE017197.PE534       Location/Qualifiers
FT   CDS_pept        complement(720483..720869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0556"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04024"
FT                   /db_xref="GOA:Q68WG8"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WG8"
FT                   /protein_id="AAU04024.1"
FT                   /translation="MTRKFHYSILFITIIAICSLFRIKDRVSTLNYQLRSVIKQINSEN
FT                   NNINILKAEQAYLLLPTRLEKLAAAYLKLEIVKSYQMINDPLAPNIEQNIKFNHNISIS
FT                   KSNKWRYKRIMNNKYIQTVSSRVK"
     atgactagaa agtttcacta ttcaatatta tttataacaa ttatagcaat atgtagttta        60
     ttccggatca aggatcgagt ctcaactctg aattatcaat taaggagtgt gataaaacag       120
     attaatagtg agaataataa tattaatatt ttgaaagcag agcaagctta tctacttttg       180
     ccaactagat tggaaaaact cgctgcggct tatttgaaat tagaaatagt gaaatcatat       240
     caaatgatca atgatccgtt agcaccaaat atcgaacaaa atattaaatt taatcataat       300
     attagtattt caaagagtaa taaatggcgt tacaaaagaa ttatgaataa taagtatata       360
     cagactgttt caagtagagt taagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page