(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE547

AE017197.PE547       Location/Qualifiers
FT   CDS_pept        738635..739495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04037"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WF5"
FT                   /protein_id="AAU04037.1"
FT                   /translation="MKTLNYKNIFDVINDYDVFLFDLWGVIIEGNHTYPGVVQNINKII
FT                   AQKKVYFVTNAPRNIFSLHKTIKSWGINALPEMIISSGEIAVQMILESKKRFNIKKPII
FT                   YHLGHLENDIINVMQCYTTDDINKANISLITIYRDENEKLDLNEFDELFKIIVQRKIIN
FT                   ICANPDLGINQHGIYRYCSGYYAEKIKQLGGKVIYSGKPYSEIYHKILKECSNIPKNRM
FT                   LMIGDTFYTDILAANRLGFDSALVLTGNSREYHFDFDNINEKLDSLMKAAIKQSIIPNF
FT                   VVDLS"
     atgaagacgt taaattataa aaatattttc gatgtaatca atgattatga tgtgttttta        60
     tttgatcttt ggggggtgat aattgaagga aatcatacat atccaggcgt cgtacaaaat       120
     attaataaaa ttattgcaca gaaaaaagta tattttgtta ctaatgcccc acgaaatatt       180
     ttttctctac ataaaacaat taaatcttgg ggaataaatg cacttccaga aatgatcatt       240
     agctcaggtg aaatagcagt gcaaatgata ctagagagta aaaagcgatt caatattaaa       300
     aaaccgataa tatatcacct aggacattta gaaaatgata taataaacgt aatgcaatgc       360
     tacaccaccg atgatattaa caaagctaat atttccttaa tcactattta tagggacgaa       420
     aatgaaaagt tagatttaaa tgaattcgac gaattattta aaatcattgt acaacgcaaa       480
     attattaata tttgtgctaa tcctgatctt ggaataaatc agcacggtat ctatagatat       540
     tgtagcggat attatgcaga aaaaataaag cagcttgggg gaaaagtaat ttatagtggt       600
     aagccatatt cagaaatata tcacaaaatt ttaaaagaat gttctaatat ccctaagaat       660
     cgtatgttaa tgattgggga cactttttac accgatatac ttgcagcaaa tcgccttggt       720
     ttcgactctg ctcttgtgtt aaccggaaat tctagagaat atcattttga ctttgataat       780
     attaatgaaa aattagatag tttaatgaaa gctgctatta agcaatcaat tatacctaat       840
     tttgttgttg atttatcttg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page