(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE555

AE017197.PE555       Location/Qualifiers
FT   CDS_pept        749180..749926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0580"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04045"
FT                   /db_xref="GOA:Q68WE7"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE7"
FT                   /protein_id="AAU04045.1"
FT                   /translation="MIIAQNKTNYQDFLKTLAIIAMTIDHIGIYLYHELTIMRIIGRIS
FT                   MPVFCFFAGYNFYDKPKTRIIVYGIILQIYTTILFKQFLTSNILISIYLGQCYIYYFRN
FT                   SVTSFFYSGSCHVVIMIILWYISWALIDYGTLVIATMILGFIAQHEKTNLKLCCCIAIF
FT                   ISIVHSTFFTLLIPLSDFNFSNTNLILNLTFLTIIYILMILSDYSQKILINLKWISRNV
FT                   IYIYCIQIIILQFIFIYKYTYGFKNW"
     atgataatag cacaaaataa aacaaattat caggattttt taaaaacttt agctattatc        60
     gcgatgacca ttgatcatat tggcatatat ctatatcacg aattaacaat tatgcggata       120
     atcggtcgta tctctatgcc agtattttgc ttttttgctg gctataattt ttatgataaa       180
     ccaaaaacta gaataatagt atacgggatt atactacaaa tatatactac tatattattt       240
     aaacagtttc tgactagcaa tattctaatt tctatctatt tagggcaatg ttatatttat       300
     tattttcgta attctgtaac tagttttttc tatagcggtt cttgccatgt agtgataatg       360
     ataatattat ggtatattag ctgggcttta attgattatg gcactcttgt aattgctaca       420
     atgatacttg gatttattgc acaacatgaa aagacgaatc taaaactttg ctgttgtata       480
     gcaattttta tttctatagt acattcaact ttttttactc ttttaattcc tttgagtgat       540
     tttaattttt caaatactaa cttaatttta aatcttactt tcttaacaat tatttatata       600
     ttaatgatct taagcgatta ttcacaaaaa atactaataa atctaaaatg gatcagtcgt       660
     aatgttatat atatatattg tatacaaatt ataatcttac aattcatatt tatctataaa       720
     tacacatatg gttttaaaaa ttggtag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page