(data stored in SCRATCH3701 zone)

EMBL: AE017197.PE556

AE017197.PE556       Location/Qualifiers
FT   CDS_pept        750001..750615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RT0581"
FT                   /product="rickettsial conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RT0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAU04046"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:Q68WE6"
FT                   /protein_id="AAU04046.1"
FT                   /translation="MNVIDLLILDNEKYKKHFRKNKLFKVKFDSTLRKNKFLKHFRIWS
FT                   DEFQKMVLARVVFSETKEFKQLAWEHLTDEFGHNIELSQNLENDKETTDSIFEALGSWF
FT                   TLKMMTLGDSERAVLVHLVIESCATIFYEKLGSIFCNHKTSQHFKTHMQLDPEHEQMGI
FT                   DLLKQININDISLLIIQKKGWDMIDALFTRLAEITTVPDNV"
     atgaatgtaa tagatcttct cattttagat aatgaaaaat acaaaaagca ctttagaaaa        60
     aacaaactat ttaaagttaa gtttgatagt acactaagaa aaaataaatt tctcaaacat       120
     ttccgtattt ggtcagatga atttcaaaaa atggtattag caagagtagt attttctgaa       180
     acaaaagaat ttaaacaact tgcatgggaa catcttactg atgaatttgg acataatata       240
     gaattatccc aaaatctaga gaatgataaa gaaactacag attctatttt tgaagcatta       300
     ggttcctggt ttacactcaa aatgatgact cttggagata gtgaaagagc agtcctagtc       360
     catttagtaa tagagtcttg tgcgacaata ttttatgaaa aactaggatc aatattttgt       420
     aatcataaaa catcacagca ttttaaaaca catatgcagc ttgatcctga acatgaacaa       480
     atgggaatag atttattaaa acaaataaat attaatgata tttctttact aatcattcaa       540
     aaaaaaggct gggatatgat tgatgctctg tttactagac ttgctgaaat tacaacagta       600
     ccagataatg tttaa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page